(data stored in ACNUC7421 zone)

EMBL: CR954246.PE549

CR954246.PE549       Location/Qualifiers
FT   CDS_pept        595491..595811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0576"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85663"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH0"
FT                   /protein_id="CAI85663.1"
FT                   /translation="MHSKRFLIVILLVLVHSFISCDGAAYHLQEDVDHITSAQLQSNIT
FT                   ADGSQNEAQASAEIHAHQHCHSGYYSTVNHSISPEQSNPALPVRYCGLIYPPMSRPPIS
FT                   LS"
     atgcattcaa agcgtttttt aatagtgata cttttagtac ttgtacacag ctttattagc        60
     tgtgatggtg ctgcgtatca tttacaagaa gacgtggatc acataaccag cgcgcagtta       120
     caaagtaata taactgccga tggtagccaa aatgaggctc aagcctctgc cgaaattcat       180
     gcccaccaac attgtcatag tggctattac agtacagtaa atcattcaat cagccctgag       240
     cagagtaacc ccgcgttacc tgtacgctat tgtggattaa tttatccacc tatgtcgcgc       300
     cctcctattt cacttagcta g                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page