(data stored in ACNUC7421 zone)

EMBL: CR954246.PE55

CR954246.PE55        Location/Qualifiers
FT   CDS_pept        complement(63081..63875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0060"
FT                   /product="putative secreted protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85169"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE0"
FT                   /protein_id="CAI85169.1"
FT                   /translation="MKKLLLMSTLICAPAVVAHNDNDSTVSFNNEQCNVEFKNDVRIKP
FT                   DELEIFTANKQTMQFNTNGNLTINGESVALNHSQQKALTQYSDSLRTQLPEVANIALEG
FT                   VKIAGVALQEVANAFNIDGLDNISSLMDDIKLEVQNTFYQQDTFVMDQQSFNQFGENFE
FT                   QQFEQQIETAVESAVMQSMGSILVALGSELLGSGGDMQAFEQRMENMGTQIEEKVEQHA
FT                   DALEKRANALCENFANIAKQEEQLVVQVPELKGYQLFSFKQN"
     atgaaaaaat tactattaat gagcacttta atatgtgcac ctgccgttgt ggcacataat        60
     gataacgatt caacagtgtc atttaataat gagcaatgta atgtagaatt taaaaatgat       120
     gtacgtatta agcctgacga actagagatt tttaccgcca ataagcaaac tatgcaattt       180
     aataccaatg gcaatttaac cattaatggt gaatcggtag cgcttaatca ttcccagcaa       240
     aaggcgctaa ctcaatattc agatagttta cgcacgcaat tacccgaagt agcaaatata       300
     gccttagaag gcgttaaaat tgcaggtgtt gcactgcaag aagttgctaa tgcttttaat       360
     attgatggcc tcgataatat ctcatcgtta atggacgaca ttaaacttga agtacaaaat       420
     actttttatc aacaagacac ctttgttatg gaccagcaaa gctttaacca atttggtgaa       480
     aactttgagc agcagtttga acaacaaata gagaccgctg ttgagtctgc tgtaatgcaa       540
     tctatgggga gtattttagt tgctttaggt tctgaattac ttggctcagg aggcgacatg       600
     caagcctttg aacaacgtat ggaaaatatg ggtacgcaaa tagaagaaaa agtagagcag       660
     catgccgatg cgctcgaaaa acgtgccaat gccttatgcg aaaattttgc caatatagct       720
     aaacaagaag aacagctagt agtacaagta cctgaactta aaggttacca attatttagc       780
     tttaaacaaa actag                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page