(data stored in ACNUC7421 zone)

EMBL: CR954246.PE550

CR954246.PE550       Location/Qualifiers
FT   CDS_pept        595995..597242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0577"
FT                   /product="putative metal ion efflux outer membrane factor
FT                   protein family"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85664"
FT                   /db_xref="GOA:Q3ILG9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG9"
FT                   /protein_id="CAI85664.1"
FT                   /translation="MLVALLCVLPVFNALANVSASENILTLKQALSNTEQQNPILKRYP
FT                   YHQKILSALKSQATLSPNPVLSVAVENVLGTNDARGVKGAEITLGLSQLIELGDKRQSR
FT                   VGFATANIKAQAIQYQNTRLALLATTAERYYSALKFQTLLALNVERKSVVTQALKTIEQ
FT                   RANAGAVSQADVSRMRYALSQVELEQVKLTSEFERARLLLNELWIDEQSSAFLAGNINV
FT                   ITPLKSQQALLDAVNLAPEFALLQQQYIQQTANLALQKANGQSDINVGGGVRYNQKNDS
FT                   SSLLFSFSMPLQISNANSGNIAAAASELALLNQQQGQLRVQLRQQVRTLYAYYQGIANQ
FT                   ATLLNKQIIPQTQTLIEQSLNSYQRGQISVLQLLDAQQAHFDSKRALIATHAELYQVLL
FT                   TLERLTGQSLIETYQS"
     atgctggtgg cactactttg cgtgctgccg gtatttaatg cgctggctaa tgttagtgcc        60
     agtgaaaata tactcacgct taagcaagcg ctgagtaata ccgagcaaca aaatccgata       120
     ttaaaacgct acccctatca tcaaaaaata ttgagcgcgc ttaaatcaca agccacactt       180
     tcgccaaacc ctgtgcttag tgttgcggtt gaaaacgtgt taggcaccaa tgatgcgcgt       240
     ggcgtaaaag gcgctgaaat aacgctcggg cttagccaac ttattgagct gggcgataaa       300
     cgccaaagta gagtaggttt tgctactgca aatattaaag cgcaggctat acagtatcaa       360
     aatactcgtt tagcgttatt agctaccacc gcagagcgtt actatagcgc acttaaattt       420
     caaaccttat tagcattaaa tgttgagcga aaaagcgttg taacacaggc gctcaaaaca       480
     attgagcaaa gagcaaatgc cggggctgta tcgcaagccg atgtaagtcg tatgcgttat       540
     gcacttagcc aagtagagct tgagcaagta aagctaacaa gtgagtttga gcgcgcgcgt       600
     ttattactta atgagctttg gattgatgag caaagtagtg cttttttagc gggaaatatt       660
     aacgtcatca cgccgcttaa gtcacagcaa gcgcttttag atgcggtaaa tttagcacct       720
     gaatttgcct tacttcagca gcaatatata cagcaaacgg ctaacttagc gctgcaaaaa       780
     gccaatgggc aaagcgatat taatgtaggt ggtggtgtgc gttacaacca aaaaaatgac       840
     tctagctcat tgttgttttc gttttctatg ccactgcaaa tcagtaatgc taatagcggt       900
     aatattgctg cagcagcaag tgaacttgcg cttttaaacc agcagcaagg gcagttgcga       960
     gttcagttac gccagcaagt acgtactctg tatgcttatt atcaagggat agcaaatcaa      1020
     gccacgttat taaataagca aataattcct cagacacaaa cattgattga gcaaagctta      1080
     aacagctatc aacgcgggca aatttcggtg ttgcagttgc tcgatgccca gcaagcacac      1140
     tttgactcta aacgcgcact cattgcaacc cacgcagagt tgtaccaagt gctacttact      1200
     cttgagcgtt taactggcca atctttaatt gagacttacc aatcatga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page