(data stored in ACNUC7421 zone)

EMBL: CR954246.PE553

CR954246.PE553       Location/Qualifiers
FT   CDS_pept        complement(601715..602965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0580"
FT                   /product="putative orphan protein ; putative membrane
FT                   protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0580"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85667"
FT                   /db_xref="GOA:Q3ILG6"
FT                   /db_xref="InterPro:IPR022227"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG6"
FT                   /protein_id="CAI85667.1"
FT                   /translation="MQSARFIPFRKQDIVDMCSEELNNNTQQTSFKQFCDLLASLIHYD
FT                   YHTVLESLKNNYAPFDPNSDTRSLAPVSADQKAQCQHEFAKDFAKVLNAANFEVITNED
FT                   LQDALNEESLFKVRLEVEFDDFEEVVFYRRGESQLTETITSFWGLRKKPLHFTNYDRVA
FT                   VFIRFKDSAYFKAKNKTPLGFEPSSTIVKLFQNVPKADLEMLFPNSEVRMRPIDKVIIG
FT                   SSALVGGAVVLITKLGASIVLLLALFAFWGGFRSEAVEMTQQHFITFAIGMGVFGSFIF
FT                   KEWSKFKNRKIKFMKALSDNLYFKNLDNNAGVFHTLIDAAEEEDIKEALLAYTFLLKSE
FT                   SGLSAQMLDEQIEHWFKSKYQCVLDFEISDALEKLVRMRLVTCSNEIEGNEVYSALSLE
FT                   HAKTILDKRWDNLFQYN"
     atgcaaagtg cgcgttttat tccctttaga aagcaagata ttgttgatat gtgtagcgaa        60
     gagctcaata acaacacaca acaaacatcg tttaaacagt tttgtgattt actagctagc       120
     ctcattcatt acgattacca tacggtactt gagtcactta aaaacaacta cgcccctttt       180
     gatcccaaca gtgacacgcg atcgttagcc cccgtatcgg cggatcaaaa agcgcagtgc       240
     caacatgagt ttgctaaaga ctttgccaag gtacttaacg ccgctaattt tgaagtaatc       300
     accaatgaag acttacaaga cgcattaaac gaagaatcac tatttaaggt gcgccttgaa       360
     gttgaatttg acgactttga agaagtggta ttttatcgcc gtggcgagtc gcagctcact       420
     gaaacgatta ccagcttttg gggtttgcgt aaaaaaccgc tgcactttac taattacgat       480
     cgtgttgcgg tgtttattcg ctttaaagat agcgcttatt ttaaagctaa aaacaaaacg       540
     ccactgggat ttgagccaag ttcaaccata gtaaagttgt ttcaaaatgt gcctaaggcc       600
     gatctcgaaa tgctatttcc taatagcgaa gtgcgcatgc gccctatcga taaggtcatt       660
     attggatcgt ctgctttagt tggcggtgcg gtggtactta ttactaaatt gggcgcatca       720
     atcgtattat tgcttgctct gtttgctttt tggggtggtt ttagaagtga agctgtagaa       780
     atgacccaac aacactttat aacctttgct atcggtatgg gcgtgtttgg cagctttatt       840
     tttaaagaat ggagtaagtt taaaaaccgc aaaataaaat ttatgaaagc cctaagcgat       900
     aacctctact ttaaaaacct cgataacaac gcgggcgtat ttcacacgct tattgatgcc       960
     gccgaagaag aagacataaa agaagccttg ctggcgtata cctttttact aaaatcggaa      1020
     agcggattaa gcgcacaaat gcttgatgag caaatagagc attggtttaa aagcaaatac      1080
     cagtgcgttc ttgattttga aattagcgac gcgcttgaaa agctggtacg tatgcgtttg      1140
     gtaacgtgta gtaacgaaat agaaggtaat gaagtgtata gcgcgctgag tttagaacac      1200
     gcaaaaacca ttttagataa gcgctgggat aatctttttc aatataatta a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page