(data stored in ACNUC7421 zone)

EMBL: CR954246.PE554

CR954246.PE554       Location/Qualifiers
FT   CDS_pept        complement(603129..603524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0581"
FT                   /product="putative transposase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85668"
FT                   /db_xref="GOA:Q3ILG5"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG5"
FT                   /protein_id="CAI85668.1"
FT                   /translation="MEYETKSHCKYLIALHLILVVKYRKQLLKGDVGDFVKQKITEIAE
FT                   RSEFNIEEIEVDKDHIHILLTISPNISVASYVRRIKQSTTQSLWSRFKWFKKQFWVKKT
FT                   FWSDGYFVCSVGNAAADTIRKYIQEQG"
     atggaatatg aaactaaatc tcactgtaaa tatttaatag cgctacattt aatacttgtg        60
     gttaaatata gaaaacaatt gttaaaaggt gatgtaggtg attttgtaaa acaaaaaatc       120
     actgaaattg cagagcgctc agaatttaat atcgaagaga tcgaggtgga caaagatcat       180
     atacacatat tgctaacgat ctctcccaat atcagcgttg cgagttacgt taggagaatt       240
     aaacaatcta caacgcaaag tctatggtcg agatttaaat ggtttaaaaa gcaattctgg       300
     gttaaaaaaa cattttggtc tgacggatat tttgtttgct ctgttggaaa tgcggctgct       360
     gatacaattc gaaaatacat tcaagagcag ggctaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page