(data stored in ACNUC7421 zone)

EMBL: CR954246.PE555

CR954246.PE555       Location/Qualifiers
FT   CDS_pept        603563..604789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0582"
FT                   /product="putative transposase (IS605)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85669"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG4"
FT                   /protein_id="CAI85669.1"
FT                   /translation="MKKTLRYNYRLNPTPEQEAKLVEFGATARGIWNLLLSENMRRYEH
FT                   DKTFLFYKDMASLLKDIKTFEEFNWIKAFDSAAAQQVARDLELALKNAFTKGRLQRFPK
FT                   HKISYKKKKLHNDSFRAVNNSNCIRIENGAISIPKVGKIPIILHRKLASKIKTVTIQYH
FT                   HGKWGCSITQEVECKTAKQVLKTITGFDINSKQTVVGSDGFVVDNPKFLKQSKTKLNQL
FT                   QRQLARRTKGSNRWQKTKQRINKLHGKISRQRLDFAHKISRQITNENDILVFEDLNVKG
FT                   MQKFNGSMVADNVMGLITQLSKYKTELEGKLYHEIGRFEKSTGVCSECGQHHVLTLNDR
FT                   YFTCTACETYQSRDLSAAKSIAKTGELDLIAAGIVARVTPTSQQKSAIKTKVFELSKFA
FT                   VGTEKKEAA"
     atgaaaaaga cgcttagata caactacagg ctaaatccta cgccagagca agaagctaaa        60
     ctcgttgagt ttggcgcgac agcgcgtggc atttggaact tattgttgtc tgagaacatg       120
     cgtcgatacg agcacgataa aacgtttttg ttttacaaag acatggcctc actacttaaa       180
     gatatcaaga cgttcgaaga gtttaactgg atcaaagcat tcgattctgc ggcagctcaa       240
     caagttgccc gcgacctgga attagcgctc aagaatgctt ttactaaagg tcgcttgcaa       300
     cgctttccaa agcacaagat ctcatataaa aagaaaaaac ttcacaacga tagttttcga       360
     gcggtcaata actcgaactg tatccgcatt gaaaatggcg ctatcagtat cccaaaggta       420
     ggcaagatac ccattatctt gcatcgcaaa ctagcaagta aaatcaagac tgtaactatc       480
     cagtatcacc acggaaaatg gggatgcagc atcactcagg aagttgagtg caaaacagct       540
     aaacaagttt taaaaacaat cacaggtttt gacattaatt caaagcaaac tgttgttggc       600
     tcagatggtt ttgtggtcga taaccccaag tttttaaagc agtcaaaaac aaagttaaat       660
     caattgcaac gccagcttgc acgccgaact aaaggttcaa atcgctggca aaaaaccaaa       720
     caacgcatca acaaattaca cggcaaaatc tcacggcaaa ggctcgactt tgcacacaaa       780
     atttcacgcc agataaccaa tgaaaatgac attttagtgt tcgaagattt aaacgtaaaa       840
     gggatgcaaa agttcaatgg cagcatggtt gccgacaatg tgatgggctt aattactcag       900
     ctttcaaaat acaaaactga gcttgaaggt aaactctatc acgagattgg caggtttgaa       960
     aaatccactg gggtttgttc tgaatgcggc caacatcatg ttttaacatt gaacgacaga      1020
     tatttcacat gtacggcttg tgaaacttac caaagccgag acttgtcagc ggctaaaagc      1080
     atagcaaaaa caggtgaatt agatttgatt gcggctggaa tcgtcgcaag ggttaccccc      1140
     acatctcagc agaaatcagc cattaaaacg aaagtcttcg agctatcgaa gtttgctgtt      1200
     ggaactgaga aaaaagaagc agcctag                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page