(data stored in ACNUC7421 zone)

EMBL: CR954246.PE556

CR954246.PE556       Location/Qualifiers
FT   CDS_pept        604947..605531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0583"
FT                   /product="conserved protein of unknown function; putative
FT                   inner membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85670"
FT                   /db_xref="GOA:Q3ILG2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG2"
FT                   /protein_id="CAI85670.1"
FT                   /translation="MAIQKKLKQKTRNFIESKHMLSGITVASFLESTIVPIPLEAVLVP
FT                   LMQARREKLWLIALMATLGCIVGALFGYALGYYLFDAVGDWVINSFSSPEQFENVKQQM
FT                   HNQGFWFVITLGIVPIPFQIAMLAAGATKYSLGLFLLASAISRAIRYFALAVVVYYAGN
FT                   KAEQLISKHKTKAMITLTVFVIGIWWLTTVI"
     atggcgattc aaaaaaagct taaacaaaaa acacgtaatt ttattgaatc taaacatatg        60
     ctcagtggca ttaccgtggc gtcgttttta gagtcgacca tagtacctat tccgcttgaa       120
     gctgttttag tacccttaat gcaagcgcgt cgtgaaaaat tatggcttat tgctttaatg       180
     gccactttgg gatgtattgt gggggcgtta tttggttatg cgctgggtta ttacttattt       240
     gatgcagttg gcgattgggt tattaatagt ttctcaagcc ccgagcagtt tgaaaatgtt       300
     aaacaacaaa tgcacaatca aggcttctgg tttgtaataa cgctaggcat agtgcctatt       360
     ccatttcaaa tagccatgct ggcagcgggg gcgactaaat attccctcgg gttattttta       420
     ttagccagcg caatttcgcg tgctatacga tattttgctt tagcggtagt tgtgtattac       480
     gctggtaata aagccgagca acttattagt aaacataaaa ctaaagccat gattacttta       540
     actgtttttg taatcggtat atggtggtta acgacggtaa tttaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page