(data stored in ACNUC7421 zone)

EMBL: CR954246.PE557

CR954246.PE557       Location/Qualifiers
FT   CDS_pept        605572..608217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0584"
FT                   /product="conserved protein of unknown function; putative
FT                   integral membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85671"
FT                   /db_xref="GOA:Q3ILG1"
FT                   /db_xref="InterPro:IPR014600"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG1"
FT                   /protein_id="CAI85671.1"
FT                   /translation="MDELIGLVGLFILAIIAGAICGFIALTQLKSLRQQVVQLTAKVNS
FT                   LLQQQEQLVPLASKQAPPQAQPQPQVSTPATVSTQVKTAAISGNEAVVTKTAKTNTFPK
FT                   KPSVLNTLFNKLRAGLEENWMTWIGAIALAFGGIFLAKYSLEAGLLSPVMRLSLGALFG
FT                   LGLIAAAGYLHYKRIIFEGFNNYIPAALASGGFITCFALALLAYSNYAMLSSTVAFVLL
FT                   AIIALSASVMAIKFGPLLAVLGIVGAYSVPIWVSSNSVNLFSLFMYVGFVSLFAAIVAH
FT                   QVQRIWLWYLLWAGHVFWYLAGFVLLESSTIWLLGVYAVASIIGLVAIPRLGVRFTLIE
FT                   FRPHSLKRLINVLPDHPLMLVFTAPFILMMLLHRFDAQFQIFSLITLVLMLFLVLKNSR
FT                   WDLWQAVCLVIAFIVLVSTQQTFDFDDALFIFKQEYGLGLILGFTLTAYGLYFGRKFPK
FT                   RLAFHITGAFSLFLMIATLYALIPNSALSTAYPLWAVILLVGSAVLIKSAQHSASLYQR
FT                   FTYWIAANANITLAITMLLNDSGLTIALAIQVLLISLLIKRHSIPMPHWPIKALVAALL
FT                   LRLTFSPWTPSYEALTIFGLHWSIVVYPLCTVLFYVAARCFNTSKMQLWLEGAALHCLA
FT                   LFITTETSYQLVGHYPQFDSLSFYEQVLLVCNWLGLGCVYLYRARIVGSLAKLYRIGGF
FT                   ALAGLAGVFALKTLVDDNPLLSAIDIGTTPIFNWLLLLWLVPAGLTLWLARLLKTINSK
FT                   AINTKVIAIVLAIAGIFTFLAINSLIRQYWQGAYIYLSKGVGNAELYSYSIIWLVLGAS
FT                   TVIVGHLKNQLLIQKVGLGLLAAVILKVFLIDMANLTGLLKAISFIGLGLSLVGLSWLF
FT                   QKLRSRANLA"
     atggatgagt tgattgggtt agtagggcta tttatattag cgataatagc aggcgctatt        60
     tgcgggttta ttgcacttac acagcttaaa agtttaaggc aacaagttgt gcagttaaca       120
     gctaaagtta atagtttact ccagcaacaa gagcaattag taccgcttgc tagtaagcaa       180
     gcgccaccac aagcgcaacc acaaccccaa gtaagcacac cagcaactgt ttcaacgcag       240
     gtaaaaactg cggctataag cggcaatgaa gctgtagtta ctaaaacagc taaaacaaat       300
     accttcccta aaaaacctag cgttttaaat acattattta ataaattacg tgcaggactt       360
     gaagaaaact ggatgacctg gataggcgcg atagcgcttg cgtttggcgg tattttttta       420
     gcaaaataca gcttagaagc tgggttactt tcacccgtta tgcggttgag tttaggtgca       480
     ttatttggcc ttggtttaat agcagctgct gggtatttac attataaacg tattatattt       540
     gaagggttta ataactatat tccggcagcc cttgctagtg gcggctttat tacttgcttt       600
     gcgctagcct tacttgctta cagtaactac gccatgctta gctccacagt tgcatttgtg       660
     ctgttggcga ttattgcttt aagtgcaagc gttatggcaa ttaagtttgg tcctttactt       720
     gctgttttgg gcattgttgg tgcctacagc gtgcctattt gggttagtag taatagcgtt       780
     aatttatttt ctttatttat gtatgttggc tttgttagtt tatttgccgc catagtggcg       840
     caccaagtac agcgtatttg gctgtggtat ttactctggg ctgggcatgt tttttggtac       900
     ttagcgggtt ttgttttact cgaaagcagc accatttggt tactgggtgt ttatgcagtc       960
     gccagtatta ttggcctcgt agctatccct cgtttagggg taaggtttac actaattgag      1020
     tttcgcccgc acagcttaaa gcgtttaatt aatgtactgc ccgatcaccc gttaatgtta      1080
     gtgtttaccg caccgtttat tttgatgatg ctattgcata ggttcgacgc gcagtttcag      1140
     atatttagct taataacttt agtgctaatg ctgtttttag tattaaaaaa tagccgctgg      1200
     gatttatggc aagctgtgtg tttagtcata gcctttatcg ttttagtcag tacccagcaa      1260
     acttttgatt ttgatgatgc cttgtttata tttaaacaag aatatggact aggtttaata      1320
     ctaggtttta ctttgactgc ttatggcctt tattttggtc gtaagtttcc taagcgcttg      1380
     gcatttcata ttaccggcgc atttagttta tttttaatga tagccacgtt atacgcactt      1440
     attcctaatt cagcgttaag tacagcgtat ccgctttggg cagttatatt acttgttggt      1500
     agtgctgttt taataaaaag tgcgcagcac agtgctagtt tgtatcagcg ttttacctac      1560
     tggatagcag caaatgctaa tattacgctc gcgattacta tgctattaaa cgacagtggc      1620
     ttaaccatag cgctggctat tcaagtgtta ttgattagct tgctgatcaa acgccacagc      1680
     atacctatgc cacattggcc tattaaagca ctggtggcag cattattatt gcgactaact      1740
     ttctcacctt ggacaccaag ttacgaggct cttactattt ttggtttgca ctggagtata      1800
     gtggtgtacc cgctgtgtac ggtgctattt tatgttgcag caagatgttt taacacatca      1860
     aaaatgcagt tatggctaga aggtgcagcg ctgcattgct tggcattatt tattaccacc      1920
     gaaaccagtt atcagctagt agggcattat ccacaatttg attcattgag tttttacgag      1980
     caagtattac tggtttgtaa ctggcttggg ttaggttgtg tgtatttata tcgcgcgcga      2040
     atagtaggga gtttagcaaa actgtatcgc attggcggct ttgcattggc gggcttagct      2100
     ggtgtgtttg cactaaaaac cttagttgac gacaatccgt tattgagtgc aatagatatt      2160
     ggtacaacgc caatatttaa ctggttattg ttattatggt tagtacctgc agggttaact      2220
     ttgtggttag caaggttact taaaactata aatagcaaag ctataaatac taaggtaatt      2280
     gcaatagttc tcgcaattgc gggaatattt accttcttgg caattaacag tttaattcgt      2340
     caatattggc aaggggcgta tatttactta tctaaggggg taggtaacgc tgagctttac      2400
     agctattcta ttatttggct ggtactagga gcaagtacgg ttattgtggg ccatcttaaa      2460
     aatcagctac taatacaaaa agtaggttta ggcttattgg ccgcggttat tttaaaagta      2520
     tttttaatcg atatggcaaa cttaacaggt ttactaaaag cgatatcgtt tattggatta      2580
     gggttatctt tagtcgggct tagctggttg tttcaaaagc tgagaagccg cgctaacctt      2640
     gcttaa                                                                 2646
//

If you have problems or comments...

PBIL Back to PBIL home page