(data stored in ACNUC7421 zone)

EMBL: CR954246.PE56

CR954246.PE56        Location/Qualifiers
FT   CDS_pept        64159..64449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0061"
FT                   /product="doubtful membrane bound protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85170"
FT                   /db_xref="GOA:Q3IDD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDD9"
FT                   /protein_id="CAI85170.1"
FT                   /translation="MALNCIALYVSNILILPIIAIIKSLVGLKHFMEWVVGKTFSYDAL
FT                   DDDFVEDEYEMLGRNQHDKNKQKVKKKLEDYLEQKRLRKNLGEDDLSDYTD"
     ttggcgctaa actgcattgc actttatgtg tcgaacattt taattttacc aattattgcg        60
     attataaaat ccttggttgg tctcaaacac tttatggagt gggttgtggg taagacattt       120
     agttacgatg cgctagatga cgattttgtt gaagacgagt acgaaatgct cgggcgtaat       180
     cagcacgata agaacaagca aaaggttaag aaaaagttgg aagactacct tgagcaaaag       240
     cgcttgcgta aaaacctagg cgaagacgat ttaagcgatt acaccgatta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page