(data stored in ACNUC7421 zone)

EMBL: CR954246.PE57

CR954246.PE57        Location/Qualifiers
FT   CDS_pept        complement(64576..65067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0062"
FT                   /product="glutathione peroxidase possibly involved in
FT                   repair of phospholipid hydroperoxides"
FT                   /function="2.4.3 : Other"
FT                   /EC_number="1.11.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11418106; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85171"
FT                   /db_xref="GOA:Q3IDD8"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDD8"
FT                   /protein_id="CAI85171.1"
FT                   /translation="MHKFHQLSATSLQGNTINFSEFAGKVVLIVNTASKCGFTYQYESL
FT                   QALHNKYASQGLVILGFPCNQFNQQEPGDAQQIEQGCLINYGVNFLMAAKVEVNGEHAH
FT                   PVFRYLKSTQPGFLTRKIKWNFTKFLIAADGSPIKRYAPFTKPEKLELTIQKALQQSNK
FT                   "
     atgcacaagt ttcatcagtt aagcgccacc agtttgcaag gtaacaccat taattttagc        60
     gagtttgctg gtaaagtcgt gcttattgta aacacggcaa gcaagtgtgg ttttacctac       120
     cagtacgagt cactacaggc tttgcataat aaatatgcta gccaaggctt agtaatttta       180
     ggatttccgt gtaatcagtt taatcagcaa gaacccggag atgcacagca gatagagcaa       240
     ggatgtttaa taaactacgg ggttaatttt ttaatggccg ctaaagtaga ggtaaacgga       300
     gagcatgctc atccggtatt tcgttatttg aaatcgacac aacctggctt tttaactcgc       360
     aaaataaagt ggaactttac taagttttta atcgcagcag acggctcacc aattaaacgc       420
     tatgcaccct ttaccaagcc agaaaagcta gagctcacca ttcaaaaagc actgcaacaa       480
     agtaataagt aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page