(data stored in ACNUC7421 zone)

EMBL: CR954246.PE58

CR954246.PE58        Location/Qualifiers
FT   CDS_pept        complement(65159..65455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0063"
FT                   /product="putative transporter protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85172"
FT                   /db_xref="GOA:Q3IDD7"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDD7"
FT                   /protein_id="CAI85172.1"
FT                   /translation="MTTILLMACITFFTRYLFLHRALPFKVGPKMQQFLSFSAPAVLTA
FT                   IWVPIVFLNDDGINLNWQNPYLSAAIVAIIVAYKTHNIYYTTIAGMGLFLILN"
     atgaccacta ttttactaat ggcctgtatt acctttttta cccgttactt atttttgcac        60
     cgcgctttac cctttaaagt tgggcctaaa atgcaacaat ttttaagttt tagtgcacca       120
     gcggtactta cggctatttg ggtacctatt gtatttttaa acgatgatgg cattaattta       180
     aattggcaaa acccttattt aagtgcggct atagtagcta ttattgtggc ttataaaacc       240
     cataatattt actacactac gattgcgggt atgggattat ttttaatttt aaattaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page