(data stored in ACNUC7421 zone)

EMBL: CR954246.PE59

CR954246.PE59        Location/Qualifiers
FT   CDS_pept        complement(65455..66117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0064"
FT                   /product="putative amino acid permease"
FT                   /function="1.2.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85173"
FT                   /db_xref="GOA:Q3IDD6"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDD6"
FT                   /protein_id="CAI85173.1"
FT                   /translation="MLPLCLAVIPWGILCGSLAIQNGFTALETQAMSLLVFAGSAQLVA
FT                   IELIAGNTPLLTILFTTFIISSRHFLYGLAVRHKVIDQPLRWRLPVSFVLTDELFAFSH
FT                   HPKAYRTKIRLIYALSAGFSFYIAWNLWTFIGIVAGTMLPDLTHLGLDFAIAATFIALV
FT                   IPGVKSLASLVTVIVAGISATLFKSTGFELWLVSSALLAMSAGYFTARITAKKERNL"
     atgttaccgc tttgtttggc ggtgatccct tggggaatac tctgtggctc actggctatt        60
     caaaatggtt ttactgccct tgaaactcaa gcgatgtctt tattagtgtt tgcggggtct       120
     gcgcagcttg tcgctattga gttaattgcg ggaaatacgc cactactcac cattttgttt       180
     actaccttta taattagctc tcggcatttt ttatatggct tagcggtacg tcataaagta       240
     attgatcaac ctttgcgctg gcgtctacct gtaagctttg tattgaccga tgagttgttt       300
     gcattttcgc accaccctaa agcctatcgt acaaaaatac gtttaattta cgcacttagc       360
     gccggtttta gcttttatat tgcatggaat ttatggacat ttataggcat tgttgctggt       420
     actatgctcc ccgatttaac ccatttgggc ctcgactttg ctatagccgc tacatttata       480
     gctttagtta ttccgggtgt taaaagcctc gcctcactcg ttacagttat agtcgcaggc       540
     attagcgcta cactgtttaa aagtaccgga tttgagttat ggctggtgag ctctgcatta       600
     ctggccatga gcgcaggata ctttacagca agaataactg ccaaaaagga gcgcaactta       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page