(data stored in ACNUC7421 zone)

EMBL: CR954246.PE60

CR954246.PE60        Location/Qualifiers
FT   CDS_pept        66290..66949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0065"
FT                   /product="putative cytochrome"
FT                   /function="1.4.2 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85174"
FT                   /db_xref="GOA:Q3IF97"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF97"
FT                   /protein_id="CAI85174.1"
FT                   /translation="MFKVKVWDGFVRSFHWLLVFSIAVLYFSIEEGMIELHFIAGFFTL
FT                   ALILTRLIWGIIGSKTAKLSALIHSPQAVITSLKANKTPLGHSAPGSYMVLLFFILIIT
FT                   QLVSGLMSSDGILTDGPLAQYVSSSTVDFANWLHSLNFDILLYAIGLHVLAIVIYKIKG
FT                   KPLVKAMITGTKQQPNEKPAILTKAPWLAWVVFLILLVVLMTTWGSEPLSYLLNLG"
     atgtttaaag taaaagtatg ggatggcttt gtcagaagct ttcactggtt attagtgttt        60
     agtattgctg tgctctattt tagtattgaa gaaggtatga ttgaactgca ctttattgct       120
     ggctttttta ccttagcact tattttaacg cgattaatat gggggattat aggcagtaaa       180
     acagctaagt taagcgcgtt aatacactcc ccgcaagcgg taataacctc acttaaagct       240
     aataaaactc cgcttgggca ttctgcgcca ggtagttata tggtgttgtt gttttttata       300
     cttattatta ctcagcttgt tagtggctta atgagtagtg atggtatttt aactgatggg       360
     cctttagcgc agtacgtgtc gagcagtaca gttgattttg ctaattggtt acatagttta       420
     aactttgata ttttacttta tgcgataggt ttgcatgttt tagcaattgt aatttataag       480
     attaaaggca agcctttagt gaaagcgatg atcaccggaa cgaaacaaca gccaaatgaa       540
     aagccagcaa tacttacaaa agcaccttgg ttagcttggg tcgtattttt aatattgctt       600
     gtagtgctta tgacaacttg gggcagtgag ccacttagtt atttacttaa cttgggttaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page