(data stored in ACNUC7421 zone)

EMBL: CR954246.PE61

CR954246.PE61        Location/Qualifiers
FT   CDS_pept        complement(67014..67466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0066"
FT                   /product="conserved protein of unknown function ; putative
FT                   cytochrome c'"
FT                   /function="1.4.2 : Electron transport"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85175"
FT                   /db_xref="GOA:Q3IF96"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF96"
FT                   /protein_id="CAI85175.1"
FT                   /translation="MKLKQVFIGALLSTCALSVSANSAFKEPSDAIEYRQAAFSMLSVQ
FT                   ISDMGAMLKGKIPFDADKFKARANNAAALAKMPWEAFYEGTDKGDTAALAAVWAENDTF
FT                   MKKATAFQQYADELAVAAQSGDKAVIGKAFGAWAKGCKDCHTQFKD"
     atgaaattga agcaagtatt tatcggggca ttattatcaa catgcgcact tagcgtatca        60
     gcaaattctg catttaaaga gccaagcgac gctattgaat atcgtcaagc tgcattttct       120
     atgctctcag tacaaattag tgacatgggc gctatgctta aaggcaaaat tccttttgat       180
     gcagataaat ttaaagcacg tgcaaataac gcagctgcac tggcaaaaat gccatgggaa       240
     gcgttttacg aaggtactga taagggtgat actgctgcac ttgccgctgt ttgggctgaa       300
     aacgacactt ttatgaaaaa agcaactgca tttcagcaat acgcagatga acttgctgta       360
     gctgcacagt ctggcgataa agctgttatt ggtaaagcgt ttggcgcatg ggccaaaggc       420
     tgtaaagatt gccacacgca atttaaagac taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page