(data stored in ACNUC7421 zone)

EMBL: CR954246.PE62

CR954246.PE62        Location/Qualifiers
FT   CDS_pept        complement(67561..68031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0067"
FT                   /product="putative integral membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85176"
FT                   /db_xref="GOA:Q3IF95"
FT                   /db_xref="InterPro:IPR021279"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF95"
FT                   /protein_id="CAI85176.1"
FT                   /translation="MDNEVINILSMAKVIQTAVAPVFLITGIAATLGVLSNRLARITDR
FT                   ARLLERRLKVSTDDDFNLSLTTELRALLKRSRCIHLAFSLSVLSALLVCAVVMLLFLSH
FT                   IQSVNLGVTIGSCFVAAMALLIFAFMSLLCEVFLATRSMRRGMIFADVDIND"
     atggataacg aagtaattaa tattttaagc atggccaaag tgattcaaac cgcggttgct        60
     cccgtctttt taattacagg tattgctgcc actttagggg ttttatcaaa ccgtttagcg       120
     cgtataacag atagagctcg tttgcttgaa cgtagactaa aagtaagcac tgatgatgac       180
     tttaatctgt cgttaaccac cgagctaaga gcgctgctaa agcgctctcg ttgtatacac       240
     cttgcattta gcttgagtgt gttaagtgca ttgttggttt gtgcggttgt tatgttatta       300
     tttttatcgc atattcaatc agttaactta ggcgtaacga taggtagctg ttttgtagct       360
     gctatggctt tgcttatatt tgcttttatg tcgctacttt gcgaagtgtt tttagccact       420
     cgcagtatgc gccgtggcat gatattcgcc gacgtcgata ttaacgatta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page