(data stored in ACNUC7421 zone)

EMBL: CR954246.PE63

CR954246.PE63        Location/Qualifiers
FT   CDS_pept        68256..71720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0068"
FT                   /product="putative serine secreted endoprotease, subtilase
FT                   family"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85177"
FT                   /db_xref="GOA:Q3IF94"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF94"
FT                   /protein_id="CAI85177.1"
FT                   /translation="MSKNIIKKTAIATAVSSAFIATLASASNLPTANITYQKAEAVKEQ
FT                   VADKKEPSAHMIVLRATTSVDAYVAGTYQQSNNREITANIEQLQDTMTLELNSLDFDAK
FT                   IIGKTKILAPTLIVQASAEALAKIAKDSRVAKVLPMFDSELHVAASSDYINAKPLIVDG
FT                   IASGKGQRVAVLDTGIDYTHQAFGGAGTVEAYLAAQADPTTVAWPQGVVKGGYDFINED
FT                   ADPIENDPANSPATGAPTNHGTSSSNSVNGIAPDVELYVYSVCGGGCPSAAQAAALEAA
FT                   MDPNGDGDISDRVDVMNMSLGGEFGDTYTGGGTQYLIQRAVELGVNMVISAGNDGDNPF
FT                   RIGGPSTTPNALSVGAMTHPTTEIGVATGTIAGVEGDIQPSSFGPQEAYTITGADIELV
FT                   YPDANQNGCVAFAADVDFTGKAVLIDRGACAFTDKVLNAQINGAEFVMIANNTDDGTPA
FT                   PMGGFDAAVTIKNVGINFAAGAALKAQLAAGGPATFDISIDIKTTSGAVATFSSRGPSM
FT                   DGLLKPEITAPGTSIDVAAAGTQTGTNPVSGTSFSGPITAGAVAMIREAHPDRNAFEIK
FT                   ATIMNAANLNVTNEPLAINPASELAPISMIGAGLVDVAKAVNLPVAAWVNNAKFNTKQA
FT                   ALSFGLESMTETASLTKTVTVKNFSADAKTYNLRTEARYQSDIDTAAISWDFPASITVP
FT                   AGQAINFDVVLTVDPAKLPEWNLNNPFSAEEVAARSAALTSVEFDGALVFDDASTDTDH
FT                   DLHLVYHAMPKAATELSVSSQIVDSEMALVVTNSGQTEIMPQAESIVAVGVEKTFAEAE
FT                   FNILATTFSAFNAEFCDSGIFVTSSIQLRDPLTHTFQAGYRLEIDTDNDGVADQFMTNL
FT                   NDRGRDTAFPGRSRTLIGETDGAGNDSWAWGTPLYHSAGEDTITFSGCSELLNIDGTLL
FT                   GEQMNFKASVGYAAYQSGVFTETDSVTGSTVFGMQPQVAFTSLETGEAVTTLKPGEKAV
FT                   VTASGPFALTQASGLDVVKVMAAADLEVPDVSAPALVGGEFTVSEDAANGTVVGALTVT
FT                   ESEFDLAISEYFVQSNTHQGLGVDADGQVVVTNTALLTGDSSAQIQVVAIDTRGNVSEP
FT                   AIVTVSITKVVPPPVVVTPEPEKKSSGSLAWLLLTAPLAFMRRRKQK"
     atgtctaaaa atataataaa gaaaacagca attgccactg ctgtctcaag cgcatttatt        60
     gcaacacttg caagtgcaag taacttacct acggctaata ttacttatca aaaagctgaa       120
     gcagtaaaag aacaagttgc agataaaaaa gaaccatcgg cacatatgat tgtattacgc       180
     gctacaacat cagtagacgc ctatgttgca ggtacttacc agcaatcaaa taatcgtgaa       240
     attacagcta atatagagca acttcaagac actatgactc ttgagttaaa tagcttagat       300
     tttgatgcga aaataattgg taaaaccaaa atattagcac ctacgttaat cgttcaagct       360
     tcggctgaag cacttgctaa aattgctaaa gattcacgag tagcaaaagt attacctatg       420
     ttcgatagcg aactgcatgt tgcagcaagc tctgactata ttaatgcaaa accacttatt       480
     gtagacggta ttgcaagcgg taaaggtcag cgtgttgcgg tattagatac aggtattgat       540
     tacactcacc aagcatttgg tggggcaggt acagttgaag catatttagc ggcgcaagcc       600
     gatcctacta cagtggcttg gcctcaaggt gttgttaaag gtggttacga ctttattaat       660
     gaagacgctg atccgataga gaacgatcct gctaattctc cagcaacagg ggctccaaca       720
     aaccatggta cttcatcttc aaactcagta aatggtattg cgccagacgt tgaactttat       780
     gtttactctg tatgtggtgg cggttgtcca agtgccgcac aggctgcagc actagaagcc       840
     gcaatggatc ctaatggcga tggtgatatt tctgaccgtg tagatgtaat gaatatgtct       900
     cttggtggcg agtttggcga cacatatact ggcggcggta cacaatactt aattcagcgt       960
     gctgttgaat taggcgttaa tatggttatt tctgcgggta acgatggtga taacccattc      1020
     cgtataggcg gcccaagtac tacacctaat gccttatctg taggtgcaat gacacaccct      1080
     acaactgaaa taggtgttgc tacaggcact attgctggtg ttgaaggtga tattcagcca      1140
     tcaagctttg gtccacaaga agcttataca attacaggtg cagacattga gttagtttat      1200
     ccagacgcta accaaaatgg ttgtgttgcg tttgccgccg atgttgattt taccggtaaa      1260
     gctgtattaa tagaccgtgg tgcttgtgca tttaccgaca aagtattaaa cgcacaaata      1320
     aatggtgcag agtttgtgat gattgcaaac aatactgatg atggtacacc agctcctatg      1380
     ggtggttttg atgctgctgt aacaattaaa aacgtaggca ttaattttgc tgcaggtgcg      1440
     gctttaaaag cacagttagc agcaggtggt ccggcaacat ttgatattag cattgacatt      1500
     aaaactacat ctggcgctgt agctacgttc tcatctcgtg gtccttcaat ggatggttta      1560
     ttaaaaccag aaattaccgc accaggtact agtattgatg ttgcagcagc aggtactcaa      1620
     actggtacta acccagtttc aggtacatct ttttcaggtc caattactgc tggtgctgtt      1680
     gcgatgattc gtgaagcaca tccagatcgt aatgcctttg aaattaaagc aacaataatg      1740
     aatgcggcta atttaaatgt aacaaacgag ccgttagcaa ttaatccagc ttcagaatta      1800
     gcacctatta gtatgattgg cgcaggttta gttgatgtag ctaaagcggt taatttaccg      1860
     gttgctgcat gggtaaataa cgctaagttt aataccaagc aagcagcgct ttcatttggc      1920
     ttagaaagca tgacagaaac tgcatcgtta actaaaacgg taacagttaa gaacttctca      1980
     gctgacgcta aaacttataa cttacgtaca gaagcgcgtt accagagcga tatagatact      2040
     gcggctatta gttgggattt ccctgcatca attactgttc ctgcaggcca agctattaat      2100
     tttgacgtag tattaaccgt tgatccagct aagttaccag agtggaatct aaataaccca      2160
     tttagcgcag aggaagttgc agcaagaagt gcagcattaa cctcagtaga gtttgatggt      2220
     gctttggtgt ttgatgatgc cagcacagat actgaccatg atttacacct tgtttatcat      2280
     gcaatgccta aagctgctac tgagctaagc gtttcatcgc aaatcgtcga tagtgaaatg      2340
     gctcttgttg ttacaaatag tggtcaaact gaaattatgc cacaagcaga aagcattgtt      2400
     gcagtgggtg ttgagaaaac atttgcagaa gctgaattta atattctagc aactactttc      2460
     tcggcgttta atgcagagtt ttgtgactca ggcatatttg ttacctcatc gattcaacta      2520
     cgtgacccac taacgcatac cttccaagcg ggttacagat tagaaattga taccgataat      2580
     gacggtgtag cagatcagtt tatgacaaac ttaaacgacc gtggccgcga tacagcgttc      2640
     cctgggcgta gccgtacgct aattggtgag acagatggcg cgggtaatga ttcatgggcg      2700
     tggggtactc cgctttatca ctctgcggga gaggacacca ttaccttttc tggttgttct      2760
     gaactactta atatagatgg gacactacta ggcgagcaga tgaactttaa agcatctgtg      2820
     ggttatgctg catatcaaag tggtgtattt acagaaactg atagtgttac aggttcaact      2880
     gtatttggta tgcaacctca agtagcattt acctcgcttg aaacaggtga agcagttaca      2940
     actcttaaac caggtgaaaa agcagttgtt acagcaagtg gtccatttgc gctaacacag      3000
     gcttcaggct tagatgttgt taaagtgatg gcagctgctg atttagaggt tccagatgtt      3060
     tcagcgccag cgcttgttgg tggtgaattt actgtttctg aagatgcagc aaacggtacc      3120
     gttgtaggtg ctttaacagt aacagagtct gagtttgatt tagctatttc agagtacttt      3180
     gttcagtcaa atactcacca aggtttgggt gttgatgccg atggtcaagt tgttgttact      3240
     aacacagctt tactgacagg tgattcttca gcccagatac aagtagtggc aattgatacg      3300
     cgtggtaatg tatcagagcc tgcaatagtt acggttagta ttactaaagt agtaccacca      3360
     ccggttgttg taacaccaga gccagagaaa aaatcttcgg gttcattagc ttggttatta      3420
     cttactgcgc cgcttgcatt tatgcgtcgt cgtaagcaaa agtaa                      3465
//

If you have problems or comments...

PBIL Back to PBIL home page