(data stored in ACNUC7421 zone)

EMBL: CR954246.PE65

CR954246.PE65        Location/Qualifiers
FT   CDS_pept        74144..74509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0070"
FT                   /product="conserved protein of unknown function ; putative
FT                   inner membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85179"
FT                   /db_xref="GOA:Q3IF92"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF92"
FT                   /protein_id="CAI85179.1"
FT                   /translation="MHDEQQLEPVKKDDRTWAMLCHLSALSGFIVPLGSVIGPLIVWLI
FT                   KKDDMPIVDVHGKKALNFQITMMIAYFVCFLLMFVVIGVILLPIVAIFSFVMVIIAAVK
FT                   ANDGKEFDYPLSLNLIK"
     atgcatgatg agcaacagct ggaacccgtc aaaaaagatg accgcacatg ggcaatgctt        60
     tgtcatttaa gtgccttgtc tggatttatt gtgccattag gctctgtaat tgggccgtta       120
     attgtgtggt taataaaaaa agatgacatg ccgattgttg atgttcatgg caaaaaagca       180
     ctcaactttc aaatcactat gatgattgct tactttgtgt gttttctttt aatgtttgtt       240
     gttattggtg taattttact gccaatagtc gctatatttt cgtttgtaat ggtgattatt       300
     gccgcggtta aagccaatga tggtaaagag tttgactacc cgttgagttt aaatttgata       360
     aaatag                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page