(data stored in ACNUC7421 zone)

EMBL: CR954246.PE66

CR954246.PE66        Location/Qualifiers
FT   CDS_pept        74593..75027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0071"
FT                   /product="conserved protein of unknown function ; protein
FT                   similar to E. coli YqaA"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85180"
FT                   /db_xref="GOA:Q3IF91"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF91"
FT                   /protein_id="CAI85180.1"
FT                   /translation="MLYLTLFISAFISATLLPSSSEVVMVAMMTQGKVNLLLLWLAATL
FT                   GNVLGSCVNYWLGTQVLRFKDKSWFPVSEQGLEKAQKQFNKYGVYSLLFAWLPIVGDPL
FT                   TVIGGIFKVRFSTFLLLVTLGKGARYLAVIALTLGVEKLI"
     atgctttatc tcacgctatt tattagcgct tttatatcgg ctactttatt gcccagctcg        60
     tcagaggtgg taatggtagc tatgatgacc caaggtaaag taaatttatt gttgttatgg       120
     ctagctgcca ctttgggcaa tgtattaggg agctgcgtta attactggtt gggtactcaa       180
     gtactgcgct ttaaagataa aagctggttt ccagtgtcag agcaggggct tgaaaaagca       240
     caaaagcagt ttaataaata cggtgtatat agtttattat ttgcctggct acctatagtt       300
     ggcgatccgc ttaccgtaat agggggaata tttaaagtgc gttttagtac gtttttattg       360
     ttggtaacac taggtaaggg ggcacgctac ttagccgtta tcgcccttac cttaggtgtc       420
     gaaaagctta tttaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page