(data stored in ACNUC7421 zone)

EMBL: CR954246.PE7

CR954246.PE7         Location/Qualifiers
FT   CDS_pept        9419..9871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0007"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85121"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ27"
FT                   /protein_id="CAI85121.1"
FT                   /translation="MKSPIKRILTLALVSFLTACSTQITLDDVLPQQKLDRTVYLRGDF
FT                   TLWDAEPQYQFTQVARSLYQAEVKFSTPGKVYEFKIADADFSEGYNCGYSDTQPAGQKL
FT                   TLGQPAVADCNTIYNYFSYTPAIKGTYIVSIDYSNYDKPQVTITKK"
     atgaaaagcc caataaaacg tattttaacc ttagcacttg ttagtttttt aactgcttgt        60
     tctacgcaaa taacgcttga tgatgtatta ccacaacaaa aattagatcg taccgtgtat       120
     ttaaggggcg actttacctt atgggatgca gagccacagt accaatttac ccaagtagcg       180
     cgatcgctgt atcaagcaga agttaaattt tcaacgcctg gtaaagtata cgaatttaaa       240
     attgccgatg ccgactttag tgaaggttac aactgtggct acagcgatac tcagccagca       300
     gggcaaaaac taacactagg ccaacctgca gttgccgact gtaatactat ttataattac       360
     tttagctata cgcccgcaat aaaaggcacc tacatagtaa gtattgatta cagtaattac       420
     gacaagccac aagtgacaat aacgaagaaa tag                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page