(data stored in ACNUC7421 zone)

EMBL: CR954246.PE71

CR954246.PE71        Location/Qualifiers
FT   CDS_pept        complement(77760..78389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0076"
FT                   /product="conserved protein of unknown function similar to
FT                   YceH of E. coli"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85185"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF86"
FT                   /protein_id="CAI85185.1"
FT                   /translation="MQLSANQQRIIGCLLEKQSTTPEHYPLSLNALTNACNQKSNRAPV
FT                   LNLTDSEVQIALDELINARLVTIDEGLSGRVNKYDHRFCNTEFSSLKFSAQQRAIICLL
FT                   LLRGAQTPGELKTRCARLANFNSVDDVELALNKLIESDIVTKLAREPGKRDCRYMHLLG
FT                   EQPISEITRPAEQATDELKSEELNELLAEVDELKTELQKIKAHLGL"
     atgcaattat cagcaaatca acagcgtatt attggctgtt tactagaaaa gcaaagtaca        60
     actcccgaac actacccttt gtcgttaaat gcgctaacta atgcgtgtaa tcaaaaatca       120
     aatcgtgcac cggttttaaa cttaaccgac agcgaagtgc aaattgcact cgatgaatta       180
     ataaatgccc gactggttac cattgatgaa gggctttctg gacgagtaaa taaatacgac       240
     caccgctttt gtaacaccga gtttagtagc ttaaaattta gtgcgcagca gcgcgcaatt       300
     atttgcttgt tactgttacg gggtgcgcaa actcccggag aattaaaaac gcgatgcgca       360
     cgattagcaa attttaatag tgtagatgac gttgagcttg cacttaataa actaattgaa       420
     agtgacatag taaccaaact tgcgcgcgag cctggtaaac gtgactgtcg ttatatgcat       480
     ttgcttggcg agcaaccaat aagtgaaata acacgccctg cagagcaagc gactgatgaa       540
     ttaaaaagtg aagaactcaa tgagttactc gccgaagtcg atgagttaaa aaccgagtta       600
     caaaaaatta aagctcactt agggctttaa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page