(data stored in ACNUC7421 zone)

EMBL: CR954246.PE72

CR954246.PE72        Location/Qualifiers
FT   CDS_pept        complement(78431..81793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0077"
FT                   /product="putative sensor protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85186"
FT                   /db_xref="GOA:Q3IF85"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF85"
FT                   /protein_id="CAI85186.1"
FT                   /translation="MSPMNNSKNNKVHNFKLTFWLSLTLIVLVSVVLDRINYNREKDAH
FT                   RLQILSEVSTYRAQLEAILVSNIQLIRGLGVAVAAEPNLQQARFAQIAAPLFETSNELR
FT                   NIGGAPDMVINMIYPLAGNEQALGLNFLDNEAQRIDAIRARDTNKIVMAGPLTLIQGGS
FT                   ALIARVPVYKADKSFWGLLSVVLDLEKVYANAGINELEKQYNVAIQGRHGLGTKGDFFY
FT                   GEPAIIEQDPLEFSLSFQGGNWQLYVAPKKGWSPVSSSIWPLRVAIIIICGLLIWAFLF
FT                   FLKMFNRQQQNEKMLEVMSDLALVGAWSFNLENKQAYWSDMTKKIFKYSPDEQPQWPKD
FT                   LGYFKPGKSREKAAKLIERAIKFGESYEAELEVIDAKGNIIWVLVHGEAEHKNDRCIRI
FT                   FGSLQNIDTRKKIELENNKISLFNEALASLTVNDQILNGQLSQSKGVITQAICQALNVD
FT                   QASIWLFSDNRTQLKPIAFHNINTTTNNNNEPWLQKDIPDFFEAIEHKAIFSAADAQQC
FT                   PILMPIKEHYLKPLKINAMLCAVIPAGSGIIGMVCAEQCNTTRAWAHNEESFLIAVAAL
FT                   VGSLYSSQKRIETEQQLVTAKETAEQAVAAKSEFLASMSHEIRTPMNGVLGMLNIVKNT
FT                   KLDQQQMHHIELAQSSAQSLLNIINDILDFSKIEAGKLDIEKIQFNLPRLLGEVVESFA
FT                   LKAEQNNTILILDATLITVSEIVSDPNRLRQILSNLISNAVKFTFDGKIVVTAKIDETT
FT                   DGTSLVCSIIDTGIGIKPEKHSTLFDSFTQADTSTTRQYGGTGLGLAIVKQLCELMGGE
FT                   VSVTSMLNEGSTFSFSIKIKPKLSKQQDLPSHLIKNKHILIIDSCLLNSTIAKKQLIIW
FT                   QANANTLTDYTAVSAYFKDQATTTLDAILIDYYFFEQAPQSQITEVKNYLAKHSCKLII
FT                   MAPMSYSKDDSTLSLKVDSMIFKPLTPSDLFDSLANDKYIEQQQQQAQLQNKLTETPLV
FT                   NTNEPQVLLVEDNKINQVVAGALLKQAGISFDIAENGREAIKQLNEQPANTYQLILMDC
FT                   QMPEMDGYQATKAIRNGDSGKHYQNITIIALTANAMQGDKEKCLAAGMNDYLSKPLDFS
FT                   ALHPKLQQWLGTQ"
     atgtcgccaa tgaataatag taaaaataat aaagttcata attttaagct gaccttctgg        60
     ctatcactta ctcttattgt attagtaagt gttgtacttg atcggattaa ctataaccga       120
     gaaaaagatg cacaccgatt acaaatactc tctgaagtaa gcacttaccg agcacaactt       180
     gaagctattt tagtgtctaa tattcagcta attcgtggtt taggtgttgc tgttgccgca       240
     gaaccaaatt tacagcaagc acgctttgcg caaattgctg cccccttatt tgagacctca       300
     aacgaactac gaaatattgg tggcgcaccc gacatggtaa ttaacatgat ctatccgctt       360
     gccggtaacg aacaagccct aggccttaac tttttagaca atgaagctca acgtatcgat       420
     gcaattagag ccagagacac aaataaaatt gtaatggctg gcccattaac gttaatacaa       480
     ggtggttctg cactcattgc tcgcgttcct gtttataaag cggataaatc cttttggggg       540
     ctgctttctg tggtattaga tcttgaaaaa gtatatgcaa acgcaggtat taatgaactc       600
     gaaaaacaat acaacgttgc tattcaagga cgccatggct taggcacaaa aggcgatttt       660
     ttttacggtg agcccgccat aatagagcaa gatcctcttg agttttcttt aagttttcaa       720
     ggcggtaatt ggcaacttta tgttgctcct aaaaagggct ggagccctgt aagttcttct       780
     atttggcctt tgcgtgtagc tataataatt atatgcggcc tattaatttg ggcgttttta       840
     ttctttttaa aaatgtttaa ccgccaacaa caaaatgaaa aaatgctaga ggttatgagc       900
     gatctggcgc tagtaggcgc ttggtcgttt aatttagaaa acaaacaagc gtattggtct       960
     gatatgacca aaaaaatatt taaatattca cctgacgaac aaccacaatg gccaaaggat      1020
     cttggctact ttaagcccgg aaaaagccga gaaaaagcag ctaaattaat tgaacgagca      1080
     attaaatttg gtgaaagcta cgaagctgaa cttgaagtta ttgatgctaa aggtaatatt      1140
     atttgggtat tggtacacgg tgaagctgag cataaaaatg atcgctgtat aagaatattt      1200
     ggctcattac aaaatattga tacccgtaaa aaaatagaat tagaaaataa taaaatatcg      1260
     ttatttaacg aagccttggc gtctttaacc gttaacgatc aaattttaaa cggacaatta      1320
     agccaatcta aaggtgtgat tactcaagca atttgtcagg cgctcaacgt agatcaagcc      1380
     agtatttggc tatttagcga caatagaacc cagctcaagc ctattgcctt tcataatata      1440
     aacaccacaa caaataacaa caatgaacca tggttacaaa aagatattcc tgactttttt      1500
     gaagccatag agcataaagc catatttagt gcagcagatg cacagcagtg ccctatttta      1560
     atgccaatta aagagcacta cctaaagcca ctaaaaataa atgccatgtt gtgtgcagtt      1620
     attcctgccg gaagtgggat cataggtatg gtttgcgccg agcaatgcaa tacaacccgc      1680
     gcttgggcgc acaacgaaga aagcttttta attgctgtag cagcacttgt tggcagcctt      1740
     tactctagcc aaaagcgtat agagacagag caacaactag taaccgccaa agaaaccgca      1800
     gagcaagctg tagctgctaa aagtgagttt ttagcgagca tgagtcatga aattcgcacc      1860
     ccaatgaatg gggtgttagg gatgcttaat attgttaaaa acacaaagtt agatcaacaa      1920
     caaatgcacc acatagagct tgctcagtcg tcggcgcaat cattactgaa tattattaac      1980
     gatattttag atttttctaa aatagaggct ggtaaattag atattgaaaa aattcaattt      2040
     aatttaccac gtttgttagg tgaggttgtt gaatcatttg cacttaaagc ggagcaaaat      2100
     aataccatct taattttaga tgcaaccctc atcaccgtca gcgaaatagt tagcgaccct      2160
     aataggttac gacaaatatt aagtaactta attagtaacg cggttaagtt tacatttgac      2220
     ggaaaaatag tagtcaccgc aaaaattgat gaaacaaccg atggtacatc tttagtttgt      2280
     tccattattg ataccggtat tggcataaaa ccagaaaaac actccacatt atttgactca      2340
     tttacccaag cagacacctc tacaacacgc caatatggcg gcacaggctt agggctcgct      2400
     attgtaaaac agttatgtga gctgatggga ggtgaagtaa gcgtaaccag tatgctaaac      2460
     gaaggcagta ctttttcgtt ttcaataaaa ataaaaccta aattaagtaa gcagcaagac      2520
     ctacctagcc atttaattaa aaacaaacat attttaatta ttgatagttg cttattaaac      2580
     tcaaccatag ctaaaaagca gctgataata tggcaagcaa atgccaatac cttaaccgac      2640
     tacactgctg taagtgcgta ttttaaagat caggcaacta caaccctcga tgctatttta      2700
     atcgactatt atttttttga acaagcgccg caatcgcaaa ttactgaggt taaaaattac      2760
     ctagctaagc acagttgtaa gctaataata atggcaccta tgagctattc caaagatgac      2820
     tctacgctaa gtttaaaagt agactcaatg atttttaagc cattaacgcc ctcagactta      2880
     tttgactctc ttgctaatga taaatacata gaacaacagc aacaacaggc acaactacaa      2940
     aataaactca ctgaaacgcc attagttaat acaaatgagc cacaagtttt attagtagaa      3000
     gacaataaaa ttaaccaagt tgttgctggg gctttattaa aacaagccgg tatttcattt      3060
     gatattgctg agaatggacg tgaggcgata aagcaactaa atgagcaacc cgctaatact      3120
     taccagttaa ttttaatgga ctgccaaatg cctgaaatgg acggctacca agcaactaaa      3180
     gcgattagaa atggcgactc gggtaagcat tatcaaaaca taactattat tgctttaact      3240
     gccaatgcaa tgcagggaga taaagaaaag tgcttagcag caggtatgaa tgattactta      3300
     agtaagccac tcgattttag tgcactgcac cctaaacttc agcaatggct tggcactcaa      3360
     taa                                                                    3363
//

If you have problems or comments...

PBIL Back to PBIL home page