(data stored in ACNUC7421 zone)

EMBL: CR954246.PE73

CR954246.PE73        Location/Qualifiers
FT   CDS_pept        complement(81911..83671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0078"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85187"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR041080"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF84"
FT                   /protein_id="CAI85187.1"
FT                   /translation="MTDKTFIKGKDRDLESSISTMQNKLKALNINIEEALWLNPVANCY
FT                   SVHIRDQDCGVMFTNGKGANDKASLASALGEYFERLSCNYFFADFYLGEEFAHAEFTHY
FT                   PTEKWFTVTNDEVPEGIMDESLWDYFDPERELNASHLFDFNSGNVKRGICTVPYTRQSD
FT                   NQDVYIPVNVIGNIFVSNGMSAGNTKFEARVQGLSEVFERAIKSRIITEGLCLPIVPEE
FT                   VVKLYPKIYEACEELRSHGFHLRIADASLGGKYPVMSVTLIHPADGSVFASFGAHPSFE
FT                   VALERTVTELLQGRRLDQLDVFQPATFDNDEVASPENTELHFIDSSGLISHDFFRAKAD
FT                   FDFVHWDFSGTTEQEYNFCTDLIHSMGHDIYIMDYTHLNVYACRILVPGMSDIYPVDEL
FT                   IWRNNNEGAKFRETFLSLDQYDVEQWMEIYDSLEEAGHSDIIRAAEFIGLVTDPDTSWD
FT                   TLRIGELKAHLCLAAGNEEAIDWVDWILHTGQVNEDAMRHFRCLKAILEIKYDDEREYA
FT                   DYQDALGLMFGTANVTLAIEIAEGRKLFNGLTFPGLSLTGFTKHAALLDGYRKLHVAKQ
FT                   QHWAREVSDS"
     atgactgata aaacatttat aaaaggtaaa gaccgcgatt tagaatcgtc gatctctact        60
     atgcaaaata agctaaaagc ccttaatatt aatattgagg aagcgttatg gcttaaccct       120
     gtagctaact gttattcggt acatattcgt gaccaagact gtggcgtaat gtttaccaat       180
     ggtaaaggcg caaacgacaa agcatcgtta gcttcggcat taggcgaata ctttgaacgc       240
     ttaagctgta actacttttt tgctgacttt tatttaggtg aagaatttgc ccatgcagag       300
     tttacccatt acccaaccga aaagtggttt acagtaacaa acgatgaagt gcctgagggc       360
     attatggatg aaagcttatg ggactacttt gacccagagc gcgaacttaa tgcatcgcac       420
     cttttcgatt ttaactctgg taatgttaag cgtggcattt gtactgtgcc atacacccgc       480
     caaagcgata accaagatgt gtatattccg gttaacgtta ttggtaatat ttttgtatct       540
     aacggtatga gtgccggcaa tactaaattt gaagcacgcg tacaaggctt atccgaagta       600
     tttgaacgcg ctataaaaag ccgcattatt actgagggct tgtgtctgcc tatcgtgcct       660
     gaagaagtcg ttaagctgta tcctaaaatt tatgaagcgt gtgaagagtt acgcagccat       720
     ggttttcatt tacgtattgc cgatgcctct ctaggcggta aatacccagt aatgagcgtt       780
     acccttattc acccagctga tggctctgta tttgcttctt ttggtgctca cccatcattt       840
     gaagtggcac ttgagcgtac cgtaacagaa ctattacaag gtcgtcgttt agatcaactt       900
     gatgtgtttc aacctgctac ttttgataat gatgaagttg cctctccaga aaacactgaa       960
     ctgcacttta ttgattctag cggcttaatt tctcatgact ttttccgcgc aaaagccgac      1020
     tttgactttg tgcattggga ctttagcggc acaactgagc aagaatataa cttttgtacc      1080
     gacttaatcc atagcatggg gcatgatatt tacatcatgg attacactca cttaaacgta      1140
     tatgcatgtc gtattttagt ccctggtatg tcagacattt acccagttga tgaactaatt      1200
     tggcgtaaca acaacgaagg cgctaagttc cgcgaaacat ttttatcact tgatcagtac      1260
     gacgttgagc aatggatgga aatttatgac tcactagagg aagcgggcca tagcgatatc      1320
     attcgcgctg ccgagtttat tggtttagta accgaccctg atacatcttg ggatacgctg      1380
     cgtattggtg aactaaaagc gcacctttgc ctagccgcag gtaacgaaga agccattgat      1440
     tgggttgact ggatattaca taccgggcaa gtaaacgaag atgcaatgcg tcactttcgc      1500
     tgtttaaaag ctattttaga aataaaatac gatgacgaac gcgaatatgc agactatcaa      1560
     gatgcattag gcttaatgtt tggtactgcc aatgtaacgc tcgcaattga aatagccgaa      1620
     ggccgtaaat tatttaacgg tttaaccttc ccaggcttat cgcttactgg ctttacaaag      1680
     catgctgcat tactcgatgg ttatcgcaag ctccatgtag ctaaacagca gcattgggca      1740
     cgcgaggtta gcgactcgta a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page