(data stored in ACNUC7421 zone)

EMBL: CR954246.PE74

CR954246.PE74        Location/Qualifiers
FT   CDS_pept        83828..86161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0079"
FT                   /product="putative hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /EC_number="3.5.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85188"
FT                   /db_xref="GOA:Q3IF83"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF83"
FT                   /protein_id="CAI85188.1"
FT                   /translation="MFKVIKRLLLLVVVLGLAGTAVVYGVLSLSLPALDGKGHSEAINE
FT                   PVIISRDVLGQAVIKAQSHNDAAYGLGYAHGQDRFFQMDLLRRNAAGELSEIFGKAALA
FT                   LDKKMRFHQLRKRSQVILKNLPESDKQLLKSYAQGVNEGLAQIGYSSFEYLLTGAQQRP
FT                   WQSEDSLLIIFSMYLDLQSATFERDQALIQIEQQYGKHMLKFLTQPSQYQAALDGSQLA
FT                   PYSAGIPKLPIPKQQTQQSSTVQSSTPAMYAFNSFAASQERGSNNWAVTGALTTTGAAM
FT                   LSDDMHLAMAVPVIWYKAQLNYVHNNVKTQVTGVSLPGAPAIVVGTNNHIAWGFTNGYI
FT                   DTADWVALTSNNKTWQVDEQIALPNNEAETYTLTLSEYGPVKYINGQAYALSWAAHQSY
FT                   AVNMQLLQLEQATEVDDALAIASDVGIPVQNLIVVDSQGSAAWKLMGGIPGRKTPSELS
FT                   VKSTDYSPLWLQNEAQRPVVKNPVSGRIWTANSRVVSAQDNERFGNGGYSLGARATQVR
FT                   DRLFEKQKFVEDDFYQLQLDNQARFLIPWHALLLKQLKADEGNNAAYISAVENWQQCAC
FT                   ASSVGYTLIKHYRDEVINITFSTLQQSLSEKNGTLSYVRRDLEPAVWQLINAQPSSWLN
FT                   PQFSTWEQQLQGAFSQTIAKLSTQYGNNIQGWQWGKVNELVIEHPFAKQIPILARFLNM
FT                   PKTPGFGDSYMPAVQGRSFGASQRFIVQPGHLENAILTVPGGQSGHPLSNFYRAGFSQY
FT                   INAENTPLLPQALVHQIIISPKGK"
     atgtttaaag taatcaagcg cttgctgctg ttagtagtgg ttttagggct ggccggtact        60
     gcggttgttt atggtgtact tagtttgagt ttaccagcgc ttgacggcaa aggtcatagc       120
     gaagcgatta atgagccggt cattatttcg cgcgacgtac ttggtcaagc tgttatcaaa       180
     gcacaaagcc acaacgatgc cgcttatggt ttggggtatg cgcatgggca agaccgattt       240
     tttcaaatgg acttactcag acgtaatgcc gctggtgagt tgagcgaaat ttttggtaag       300
     gcggcgctag cactagataa aaaaatgcgt tttcatcaat tgcgtaaacg cagccaagtt       360
     attttaaaaa atcttcctga gtcggataag caattactta aaagctacgc tcaaggggtt       420
     aacgaagggt tagcgcaaat aggttactca agctttgaat atttgctcac tggtgcacag       480
     caaaggccat ggcaaagcga agatagccta ttaataattt ttagtatgta tcttgattta       540
     caaagtgcca cctttgagcg cgaccaagca ttaattcaaa ttgagcagca atacggcaaa       600
     catatgctca aatttttaac gcaacctagt caataccaag ctgcgcttga tggcagccaa       660
     ctagcacctt acagcgcagg catacctaaa ctaccaatac ccaagcaaca aacgcagcaa       720
     tcatccactg tgcaatcatc aacaccagca atgtatgcat ttaattcttt tgcagcaagc       780
     caagagcgcg gcagtaataa ctgggcagtt accggcgcat taactacaac cggagctgct       840
     atgctctccg atgacatgca cctagcaatg gcggtgcctg tcatttggta caaagcgcaa       900
     ctaaattatg tacataacaa tgtaaaaacc caagttacgg gcgtatcgtt accgggtgcg       960
     ccagctattg tagtaggcac taataatcat atcgcatggg ggtttaccaa tggttatatt      1020
     gataccgcgg attgggttgc gcttacaagt aacaataaaa cgtggcaagt agatgagcaa      1080
     attgcattac ctaataatga agccgaaact tacacactta ccctgagcga atatggcccg      1140
     gtaaaatata ttaacgggca agcttatgca ctgagctggg cggcgcatca aagttatgcg      1200
     gttaatatgc aattattaca gctcgaacag gctaccgaag ttgatgatgc ccttgctata      1260
     gccagcgatg taggtattcc ggtacaaaat ttaattgtag ttgatagcca aggcagtgcc      1320
     gcatggaagt taatgggggg gattcctggg cgtaaaacac ccagcgagct tagtgttaaa      1380
     agtactgatt actcgccgct ttggttgcaa aatgaagcgc agcgccccgt ggttaaaaac      1440
     ccagtaagtg gacgaatatg gactgcaaac tcacgggtgg taagtgctca ggataacgag      1500
     cgttttggta acggcggata ttcacttggc gcgcgtgcaa cacaagtgcg cgaccgcttg      1560
     tttgaaaaac aaaaatttgt tgaagatgat ttttatcaat tacagcttga taaccaagca      1620
     cgatttttaa ttccttggca cgctttattg ctcaagcaac tcaaagccga tgaaggtaat      1680
     aacgccgcgt atattagcgc tgttgaaaac tggcagcagt gcgcgtgtgc aagctcagta      1740
     ggttatacct tgataaagca ttatcgcgat gaagtgatta atattacctt tagtacgttg      1800
     cagcaaagct taagtgagaa aaatggcacg ttgagctacg taaggcgtga cttagaaccg      1860
     gcagtttggc agcttattaa cgcgcaacca agtagttggc tcaatccaca attttcaact      1920
     tgggagcagc agctgcaggg ggcatttagt caaactattg ctaaactcag tacgcaatac      1980
     ggtaataaca ttcaaggctg gcagtggggc aaagtaaacg agctggttat agagcatccg      2040
     tttgctaaac aaataccaat acttgcccgc tttttaaata tgccaaaaac gccagggttt      2100
     ggtgatagtt acatgccagc agtgcagggg cgtagctttg gtgcttcaca gcgctttatt      2160
     gtacagcccg gacatttaga aaacgccatt ttaaccgtac ctggcgggca gtcggggcac      2220
     ccgttatcaa acttttatcg tgccggtttt agtcaatata ttaatgcaga aaacacgcca      2280
     ttattaccac aagcgctagt acatcaaata ataatatcgc caaaaggcaa gtag            2334
//

If you have problems or comments...

PBIL Back to PBIL home page