(data stored in ACNUC7421 zone)

EMBL: CR954246.PE75

CR954246.PE75        Location/Qualifiers
FT   CDS_pept        86306..87157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0080"
FT                   /product="putative secreted hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85189"
FT                   /db_xref="GOA:Q3IDS0"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS0"
FT                   /protein_id="CAI85189.1"
FT                   /translation="MKKLLPALITGLLLSSAAYADESVVKTQKLSEHIYMLLGQGGNIA
FT                   VSVGDDGIYIIDDQFAKLSSDIKKTISDLQPGSTEFVINTHHHGDHTGGNENFAKAGAH
FT                   VIAHDNVHKRLVAEHGEGSDFLPRISFSHDLKLHFNNEHAHVMHYQHAHTDGDAVIFFN
FT                   KANIVHMGDIFFNFGSLPFVDVDSGGSVDGILAAVDDVVKQIDDNTKVIPGHGPLSDRS
FT                   GLVVYRKLVQKAKDVMLKAMQNKASLEQVLNADPLAELGLEYASWLPKERVTTLFYRSL
FT                   KQ"
     atgaaaaaat tacttcccgc attaatcact ggtttgttgt taagtagtgc ggcttatgcc        60
     gatgaaagtg tagttaaaac gcaaaaactg agcgagcata tttatatgtt acttggtcaa       120
     ggaggcaata ttgctgtaag tgtcggcgac gatggtattt atattataga tgatcaattt       180
     gccaagcttt caagcgatat taaaaaaacg attagcgatt tacagcccgg cagtactgag       240
     tttgtaatta acacccatca tcatggcgac cacaccggag gcaacgaaaa ttttgctaaa       300
     gcaggtgccc acgttattgc tcacgataat gtgcataagc gcttagtagc ggagcatggt       360
     gaagggtcag attttttacc acggattagt tttagccacg atttaaagct gcactttaac       420
     aacgaacatg ctcatgtaat gcattatcag catgcacata ctgacggtga cgcagtcata       480
     ttttttaaca aggctaacat tgtacacatg ggcgacattt tctttaactt tggcagctta       540
     ccgtttgtag atgtagacag tggtggcagt gttgatggta ttttagcggc tgtagatgac       600
     gtagtgaaac aaattgacga taatacaaaa gtgatcccag gacatggtcc gctaagcgat       660
     cgttcagggc tggtggtgta tcgtaagctg gtgcaaaaag ccaaagatgt tatgcttaaa       720
     gcaatgcaaa acaaggcaag cttagagcaa gtacttaacg ccgacccatt ggcagagctt       780
     ggccttgaat acgctagctg gttacctaaa gagcgtgtaa ctacactttt ttatcgtagt       840
     ttaaaacaat aa                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page