(data stored in ACNUC7421 zone)

EMBL: CR954246.PE76

CR954246.PE76        Location/Qualifiers
FT   CDS_pept        87246..88817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0081"
FT                   /product="putative hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85190"
FT                   /db_xref="GOA:Q3IDR9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR9"
FT                   /protein_id="CAI85190.1"
FT                   /translation="MTVEKTHLEICNLTKEQYPQIKTLMDQAYPDLGGAWPSHTIFRLI
FT                   DQFPEGQIGIVDDGVLVGLALSVQVDYARFSNPHTYEDIADGHDRVFSDTAGDALYGLD
FT                   VAISETHRGMRLGRRLYDARKELCRQYNLRAILAGGRIPRYYNHSNEMTPMEYIAKVDQ
FT                   KELYDPILSFQLANDFQVKRLLKKYLPEDQESVGYATLLEWNNILYEPTDTVINIVKSI
FT                   VRVGAVQWQMRKVESVEEMLKQVEYFVDTVSDYQSDFILFPEFFNAPLMGLTEQVNQTE
FT                   AIRNLAEYTETFKNAMSRMAIEYNANIITGSMPVADGDKIYNVSYLCHRSGKIDEQRKI
FT                   HITPHEQNDWVIQGGDKIAVFETDAGRVGIQICYDVEFPELSRIMAKEGLEILFVPFWT
FT                   DTKNSYLRVRHCAQARAIENECYVVIAGSVGNLPEVESLDVQFAQSAVLTPSDFSFPHD
FT                   ATLNEATTNTEMLLFSDLDMDKLKILHSEGTVRNLKDRREDLYDIMLKKVSDDKKVSAD
FT                   KQKSSF"
     atgacggtag aaaaaaccca tctcgaaatt tgtaatttaa ctaaagagca atacccacaa        60
     attaaaacct tgatggatca agcataccca gatttaggtg gtgcatggcc tagccataca       120
     atttttagat taatagacca gtttccagaa gggcaaatag gcattgtgga tgatggtgtg       180
     ctggtaggct tagcattaag cgtgcaagta gactatgccc gcttttctaa cccccatacc       240
     tatgaagata tagccgatgg tcatgaccgc gtatttagtg ataccgctgg cgatgcactg       300
     tatggcttag atgttgcgat tagcgaaacg cacagaggta tgcgccttgg gcgtaggctg       360
     tacgatgccc gaaaagaatt gtgccgccaa tacaacttac gcgctatttt agcgggtggt       420
     cgtattccgc gttattacaa tcacagtaat gaaatgaccc caatggaata tatagctaaa       480
     gtagatcaaa aagagctgta cgatcctatc ttaagttttc agctagcaaa cgattttcaa       540
     gttaaacgct tacttaaaaa gtatttaccc gaagatcaag aatcagtagg ttatgccaca       600
     ttactggagt ggaataacat attgtacgaa ccaaccgaca ccgttattaa tatcgtaaag       660
     tcgattgtgc gtgtaggtgc ggtgcagtgg caaatgcgta aggtggagtc ggtagaggaa       720
     atgctcaagc aggtcgagta ttttgttgat acggtttctg attatcaaag tgactttatt       780
     ttattccctg aattttttaa tgccccgcta atgggcttaa ctgagcaagt taatcaaacc       840
     gaagcgatcc gcaatttagc cgagtacaca gaaaccttta aaaatgctat gtcgcgtatg       900
     gcaattgaat acaatgccaa tattattacc ggctcaatgc cagtagccga cggggataaa       960
     atttataacg ttagttattt atgtcaccgc agcggtaaaa tagatgagca acgtaaaatt      1020
     catattaccc cgcatgagca aaatgactgg gttattcaag gcggcgacaa aatagcggta      1080
     tttgaaactg atgcagggcg tgttggtatt caaatttgtt acgatgttga gtttccagaa      1140
     ctatctagaa ttatggccaa agaaggctta gaaattttat ttgtaccttt ttggactgat      1200
     actaaaaata gctatttacg ggtacgtcat tgtgctcaag cacgcgctat tgaaaacgaa      1260
     tgttatgtgg ttatagcagg ctctgttggt aacttaccag aagtagaaag cctagatgta      1320
     cagtttgcac aatcggcagt acttacaccg tctgactttt cattcccaca tgatgcaaca      1380
     ctcaatgagg caaccactaa taccgaaatg ttgttattta gtgaccttga tatggataaa      1440
     ttaaaaattc ttcacagcga agggacagta cgtaacttaa aagatcgacg tgaagattta      1500
     tacgacataa tgctaaaaaa agtgagcgac gataaaaagg ttagtgcgga taagcaaaaa      1560
     agtagctttt aa                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page