(data stored in ACNUC7421 zone)

EMBL: CR954246.PE77

CR954246.PE77        Location/Qualifiers
FT   CDS_pept        88953..89261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0082"
FT                   /product="putative exporter protein (SMR family)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 11948170; Product type m : membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85191"
FT                   /db_xref="GOA:Q3IDR8"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR8"
FT                   /protein_id="CAI85191.1"
FT                   /translation="MYLIIAGLLEIGWPIGLKISQQSDSRWLGIGIAVAFMVVSGFMLW
FT                   LAQRDIPMGTSYAVWTGIGAAGTFIVGILFYGDAATFGRIAGVLMIICGVITLKISH"
     atgtatttaa taattgcggg cttgcttgaa attggctggc caataggctt aaaaatttcg        60
     caacaaagtg acagccgctg gttaggtatt ggcattgcgg ttgcatttat ggtggttagt       120
     ggttttatgt tgtggctagc tcaacgtgat attcctatgg gtacatctta tgcggtatgg       180
     acaggcattg gcgctgctgg cacatttatt gtgggcattt tgttttatgg tgatgccgcc       240
     acttttggcc gtattgccgg tgtattaatg attatttgcg gtgtgatcac acttaaaata       300
     agtcattaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page