(data stored in ACNUC7421 zone)

EMBL: CR954246.PE78

CR954246.PE78        Location/Qualifiers
FT   CDS_pept        complement(89331..90173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0083"
FT                   /product="conserved protein of unknown function ; putative
FT                   integral inner membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85192"
FT                   /db_xref="GOA:Q3IDR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR7"
FT                   /protein_id="CAI85192.1"
FT                   /translation="MQAWRNALQSKLSSNVSVAGVTLSRFIVAGPIAAVYLYGLYQYQD
FT                   TAMPSFNNAFWGFIIGASIMQILATGLMVKLFKMNNYAVGAGLAKSEALVAAILGVLFF
FT                   GSALTLLGWLGVFLGAIAVLLMSGITSIKRFDAKTALLGLACGTCFALTSLWVREGSLN
FT                   SGLLFPHSAAWVLLFVISLQTLILLGYLLLKEPHTLSKLWQYKGTTVAISIFSCVGSIG
FT                   WFSAMSLQHVAYVKTLGQIEVFFTILIAVLWLKQPLKKQDSAGLLLIAVAAILVMLPN"
     atgcaggcgt ggcgcaatgc actacaaagt aagttaagta gtaatgtgag cgtagctggc        60
     gttactctat cgcgctttat tgttgcaggc cctattgctg ctgtgtattt gtatggttta       120
     tatcaatacc aagataccgc tatgcctagt tttaataatg ctttttgggg ctttattatt       180
     ggcgcaagta ttatgcaaat tcttgctact ggcttaatgg ttaaattatt taaaatgaat       240
     aattacgctg tgggcgctgg gcttgcaaaa agtgaggctt tggttgccgc tattttagga       300
     gtattatttt ttggctcggc gttaacctta ttgggttggt tgggggtatt tttaggggct       360
     attgccgtac tgctaatgag cggtataacc agcattaaac gcttcgatgc caaaacagct       420
     ttattagggc ttgcgtgcgg tacttgcttt gcgcttactt cattatgggt acgtgagggc       480
     agtttaaatt cagggctatt atttcctcac tctgctgctt gggtactgct ttttgttatt       540
     agcttacaaa ctctaatatt gctgggttat ttattattaa aagagccaca caccctcagt       600
     aaactttggc aatataaagg cacaactgtc gcgattagta tttttagctg tgtgggctct       660
     attggctggt ttagcgccat gagcttgcag catgttgcct atgtaaaaac gcttggccaa       720
     atagaggtgt tttttaccat actcattgcc gtactgtggc taaaacaacc gcttaaaaaa       780
     caagacagcg ccgggttatt actcattgct gttgccgcta ttttagtcat gctgcccaat       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page