(data stored in ACNUC7421 zone)

EMBL: CR954246.PE79

CR954246.PE79        Location/Qualifiers
FT   CDS_pept        90432..90815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0084"
FT                   /product="putative membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85193"
FT                   /db_xref="GOA:Q3IDR6"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR6"
FT                   /protein_id="CAI85193.1"
FT                   /translation="MTILIACALLAIVMPYLARIPAVIELNKLGGYDNKHPRQQQTQLT
FT                   GLGARALAAHQNCFESLAVFAVALAVVLGTNNVNAVTETLAMSHIVARVLFCAFYYLNL
FT                   DIMRSIMWFVGISTAIAMIAVSF"
     atgactattt taatcgcttg tgctttattg gccattgtaa tgccttattt agcaagaata        60
     cccgcagtaa tcgaacttaa taaattgggc ggctacgaca acaagcatcc gcgccaacaa       120
     caaactcaat taaccggttt aggagcgcgc gctttagctg cacaccaaaa ctgttttgag       180
     tcgttagcag tatttgccgt tgcacttgcg gtggtattag gcactaataa tgttaatgcg       240
     gtaaccgaaa ccttggctat gagccacatt gtagcgcgtg ttttattttg tgctttttac       300
     taccttaacc tagatattat gcgctcaatt atgtggtttg ttggtataag tacagctatt       360
     gcaatgattg cagtgagctt ttaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page