(data stored in ACNUC7421 zone)

EMBL: CR954246.PE8

CR954246.PE8         Location/Qualifiers
FT   CDS_pept        9961..10914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0008"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85122"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ26"
FT                   /protein_id="CAI85122.1"
FT                   /translation="MNNYIEYCYLENDKPSYERIKLTESDLSECINKYRVFSRKLEIEN
FT                   LFDVLIEEFKTFKSLLTMAQLSQEFSHFSEVHAYIENQKARTKLNISYLSILNTGKLVL
FT                   DRLYNKRDNFSIINDIDQSLLPELLIERERIFKENQYYVLCCNLRNLCQHKMLPVNRLT
FT                   LKYPSKSTYGNGVITKFQIPLVLSAMEEAERIKLLRGLNSAFIDELLKSDLVDLNRAID
FT                   GYFEGIFDLMIKLRTLVNKSVTETEDYFSKLLDQNINLNMKRLLGPPALVVNNEKEFHL
FT                   DFEWFRVAHYLEEKNNLYFKSANLIRTQYIEAPSST"
     ttgaataatt atatagagta ctgctatcta gaaaatgata agcctagcta tgaacgaatt        60
     aagttaactg aatccgactt atctgagtgc ataaataaat atagagtatt ctcacgaaaa       120
     cttgagatag aaaatttatt tgacgttttg atagaggagt ttaaaacatt caaatcattg       180
     cttactatgg ctcaactttc acaagagttt tcacatttct ctgaggtaca tgcttatata       240
     gaaaatcaaa aagcccgtac taaattaaat atctcctatc taagtatttt gaatactgga       300
     aaattagttt tagatcggtt gtacaataaa cgtgataatt tttcgataat taatgatatt       360
     gatcaatctt tattacctga actattaata gaaagagaga ggatctttaa agagaatcag       420
     tattatgttc tatgctgtaa tttgagaaat ttatgccaac ataaaatgtt gccagtaaat       480
     aggctaactt taaaatatcc atctaaaagt acatatggaa acggcgtaat aacaaaattt       540
     cagattccac tcgtattatc ggcaatggaa gaggcagaaa ggataaagtt gttaagggga       600
     ctaaactctg catttataga tgagctctta aagtctgatt tagttgacct caatagagcg       660
     atagatggtt attttgaagg aatttttgat ttaatgatta aattacgcac cctggtaaat       720
     aaatcagtta ctgagactga agattatttt agtaagttac ttgatcaaaa tataaactta       780
     aacatgaagc gactcttggg gccgccagca ttagtagtta acaatgaaaa ggaatttcac       840
     ttggattttg agtggttccg agtcgctcac tatttagaag aaaaaaataa tttatatttt       900
     aagagtgcaa acttaatcag aacacaatac attgaagcac ctagcagcac ctag             954
//

If you have problems or comments...

PBIL Back to PBIL home page