(data stored in ACNUC7421 zone)

EMBL: CR954246.PE80

CR954246.PE80        Location/Qualifiers
FT   CDS_pept        complement(90852..91541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0085"
FT                   /product="putative ribosomal RNA pseudouridylate synthase"
FT                   /function="3.2.3.2 : rRNA modifications"
FT                   /EC_number="4.2.1.70"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 11720289, 14659742, 14730022; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85194"
FT                   /db_xref="GOA:Q3IDR5"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR5"
FT                   /protein_id="CAI85194.1"
FT                   /translation="MSTKIRLAKYIAHAGVCSRKQASRLIDEGAVIVNNRPANHIDHVD
FT                   EQDQITVNGQIIKGTAELIYFAYHKPVGIDCKLDQNDPASLYHHLPTITRVYPIGRLDK
FT                   DSRGLLILTNDGELCNQLIHPDFHQPKRYLVSVNKSIDAEFCTKMAAGVPVDKQITLPC
FT                   SVEKIADKQFSIILKQGLNRQIRKMAHYCGYKVIDLYREQISELTLQTLNLAQGQYIAI
FT                   NKSDIIK"
     atgagcacca aaattcgact cgctaaatac attgcccatg ctggtgtttg ctcgcgtaaa        60
     caagcctcac gcttaattga cgaaggtgca gtgatagtaa ataaccgccc ggctaatcat       120
     attgaccatg ttgatgagca agaccaaata acagttaacg ggcaaattat taaaggcact       180
     gctgagttaa tttattttgc ttatcataag cctgtaggta ttgactgcaa gcttgatcag       240
     aatgaccctg ctagccttta tcaccacctg cctactatta cgcgggttta ccctattggc       300
     cgtcttgata aagactcccg tggcttgctt atattaacca acgatggtga gttgtgtaac       360
     caactaattc atcccgactt ccaccagcca aaacgttact tagttagcgt taataaaagc       420
     attgatgccg agttttgtac aaaaatggcc gcaggtgtac cggtagataa gcaaataacc       480
     ttgccctgta gcgttgaaaa aatagcagac aaacaattta gtattatttt aaagcaaggg       540
     cttaataggc aaattagaaa aatggcacac tattgtggtt acaaggtaat tgacttgtat       600
     cgcgagcaaa ttagcgagct aaccctgcaa acgctaaacc ttgcccaagg gcaatatatt       660
     gcaattaata aaagcgatat tataaagtaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page