(data stored in ACNUC7421 zone)

EMBL: CR954246.PE81

CR954246.PE81        Location/Qualifiers
FT   CDS_pept        complement(91554..91739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0086"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85195"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR4"
FT                   /protein_id="CAI85195.1"
FT                   /translation="MHIIDTLTPLIFIKLKIIKPTAAYKNAYSVAPNTKFIAIYPPSVM
FT                   FTWQLCYNLLHTFAND"
     ttgcatataa ttgatacatt aacgcctcta atatttataa aattaaaaat tattaaacca        60
     acagctgctt ataaaaatgc atattctgta gcgcctaaca ctaaatttat agctatttac       120
     ccaccttcag taatgtttac ttggcagctt tgctataatc tgctgcacac ttttgccaat       180
     gactaa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page