(data stored in ACNUC7421 zone)

EMBL: CR954246.PE82

CR954246.PE82        Location/Qualifiers
FT   CDS_pept        91721..92131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0087"
FT                   /product="putative acetyltransferase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85196"
FT                   /db_xref="GOA:Q3IDS5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS5"
FT                   /protein_id="CAI85196.1"
FT                   /translation="MYQLYANNDDCLNQALRQKIVAFNSAHFDAERMSIGYQFLDAQEE
FT                   LVAGISGCVFGNWLQINWLWCSELVRGNGLATKLLVALEAAAVELGATRGQLDTLDFQA
FT                   KPFYEKHGYQVKYQLNNYPRTGTRYFMEKSLI"
     atgtatcaat tatatgcaaa taatgacgat tgcttaaatc aggcgcttcg tcaaaaaata        60
     gtggcgttta atagcgcgca ttttgatgct gagcgtatgt ctattggtta tcagttttta       120
     gacgcacaag aggaattggt cgctgggatt agtggctgtg tatttggcaa ttggttgcag       180
     ataaattggc tttggtgcag cgagttagta cgtggcaatg gcttggcgac taagttatta       240
     gtcgcacttg aagcggctgc agttgagctt ggggcaacga gggggcagct cgatacgctt       300
     gattttcaag ccaagccttt ttatgaaaag cacggttacc aagttaagta tcaacttaat       360
     aattatccgc gcacgggtac tcgctatttt atggaaaaat cgcttattta a                411
//

If you have problems or comments...

PBIL Back to PBIL home page