(data stored in ACNUC7421 zone)

EMBL: CR954246.PE83

CR954246.PE83        Location/Qualifiers
FT   CDS_pept        complement(92146..92502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0088"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85197"
FT                   /db_xref="InterPro:IPR014984"
FT                   /db_xref="InterPro:IPR038604"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS4"
FT                   /protein_id="CAI85197.1"
FT                   /translation="MTLSDYLEKLANEPKSIEFTDTMAIIDTHYRFTPCAFNNHGLLSA
FT                   ASENNGSCKIFAFAKLNQLSKQNTLDCFGQFYHQDVLNNPKGSDHMNIRTFMLAPEVTP
FT                   FLGVTFTGEPLKAI"
     gtgactctaa gtgactacct agaaaaattg gcaaatgagc caaaaagcat cgaatttacc        60
     gacactatgg caattatcga tacacattac cgcttcaccc cttgcgcatt taataatcat       120
     ggtttactta gtgctgcgag cgagaacaat ggttcttgca aaattttcgc ttttgcaaaa       180
     ctaaaccaac ttagtaaaca aaatacgctc gattgctttg gtcagtttta tcatcaagat       240
     gtgcttaaca accccaaagg tagcgatcat atgaatattc gcacctttat gcttgctcct       300
     gaagtgaccc cgtttttagg cgtaaccttt acaggcgagc cacttaaagc tatttaa          357
//

If you have problems or comments...

PBIL Back to PBIL home page