(data stored in ACNUC7421 zone)

EMBL: CR954246.PE84

CR954246.PE84        Location/Qualifiers
FT   CDS_pept        complement(92582..93286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0089"
FT                   /product="putative enzyme with a phosphatase-like domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85198"
FT                   /db_xref="GOA:Q3IDS3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS3"
FT                   /protein_id="CAI85198.1"
FT                   /translation="MIRFNRAIAPVSVLSFDLDDTLYDNRPIIKAAVQAQTDYLNTLPG
FT                   YQHQGLQQWLHCRDCALQQQPKLIEDVTQWRLQTLGLLLAKQGFNADDAKHFASAAYKV
FT                   FAQARSNITVTDDVLNLLDKLATRFTLIAITNGNADVSQFNLNNKFNLVLQAGLHGKAK
FT                   PHNNLFDQAATHLQVPHKAILHIGDSLDSDVQGANNAGCQSVWLNNQAANYTYKGLADI
FT                   EITNINALSHLI"
     atgatccgct ttaatcgtgc cattgcacct gtgtcggtat taagcttcga cctagacgat        60
     accctttacg acaatcgccc tattattaaa gccgccgtac aagcgcaaac tgattattta       120
     aataccctgc cgggttatca acatcaaggc ttgcagcaat ggctgcattg tcgtgattgt       180
     gcactgcaac agcagccaaa attaattgaa gatgtaacgc agtggcgttt gcaaacactg       240
     ggcttacttc ttgctaagca aggctttaat gccgacgacg caaaacactt tgcaagtgct       300
     gcgtacaagg tatttgctca agctcgcagt aatataaccg tgaccgatga cgtacttaac       360
     ttactcgata agctcgctac tcgctttacc cttatagcca taaccaacgg caatgccgat       420
     gtgagccagt ttaatttaaa taataaattt aacttggtac tgcaagcggg tttacacggt       480
     aaagctaaac cgcacaataa cttgtttgat caagcagcta cacatttaca ggtgccacac       540
     aaagctattt tacacattgg tgacagccta gatagcgacg tgcaaggcgc taataatgcc       600
     ggctgccaat ctgtatggtt aaataaccaa gctgccaact atacttacaa aggccttgcc       660
     gatattgaaa taactaacat taatgcctta tcacacttaa tttaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page