(data stored in ACNUC7421 zone)

EMBL: CR954246.PE86

CR954246.PE86        Location/Qualifiers
FT   CDS_pept        complement(94242..94853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0091"
FT                   /product="conserved protein of unknown function conserved
FT                   in bacteria"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85200"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS1"
FT                   /protein_id="CAI85200.1"
FT                   /translation="MSELNAQQVVDYLQHHPDFLIQHPELLAQLELQQQAQGATSLVHI
FT                   QQRQLREHNTLLKNQIASMNKYAAQNEQVYRLFSLCHQQLCSNNDFDALASNLQDIICS
FT                   NPDISDCRLVKYDTKYAQLVEHRLSNSGHYLGRINQQERDLLFSDTAQSTAIYLIGDIN
FT                   KPIAILAFASNNANHFEPAQDTLFVLDFVVALQSRLLELA"
     atgagtgagc taaacgcgca gcaagtggta gattatttac aacaccaccc tgatttttta        60
     attcagcacc ctgagctact tgctcagctt gagctgcaac aacaagccca aggtgcaaca       120
     tctttggtgc atattcagca gcgccaattg cgcgagcaca atacgttgtt aaaaaatcaa       180
     attgccagca tgaacaaata cgctgcacaa aatgagcaag tgtatcgctt atttagccta       240
     tgccatcaac agctttgcag taataacgac ttcgatgcgc ttgccagtaa cttacaagat       300
     attatttgta gcaatccaga tattagcgac tgtcggttag taaagtacga cactaaatat       360
     gctcaacttg ttgagcatcg cctgagtaat tcagggcact atttagggcg tattaatcag       420
     caagaacgag atttgttatt tagcgatacg gcgcaatcaa cggctattta tttaattggt       480
     gatattaaca agccaattgc tattttggct tttgccagca acaacgccaa ccactttgag       540
     cccgcacaag acaccctttt tgtactagac tttgtagtcg ctctgcagtc aaggttgctg       600
     gaacttgcat ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page