(data stored in ACNUC7421 zone)

EMBL: CR954246.PE91

CR954246.PE91        Location/Qualifiers
FT   CDS_pept        97645..98316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0096"
FT                   /product="putative phospholipase/carboxylesterase family
FT                   protein"
FT                   /function="5.2 : From other organisms"
FT                   /EC_number="3.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85205"
FT                   /db_xref="GOA:Q3IEV9"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEV9"
FT                   /protein_id="CAI85205.1"
FT                   /translation="MAIIVMSLEFVEYPAQGEHKATVIWLHGLGDSGEGFAPVAPQLQL
FT                   PNELGLRFIFPHAPVQPVTINGGMEMRSWYDIKSIELDKRADEQGVRDSAAKVEQLINQ
FT                   EIANGIAADKIILAGFSQGGVVALHLAPRFEQKLAGVMALSTYMCVPEKLADEALHTDL
FT                   NIFMAHGSQDNVVPPSAGKSAFEVLTALSMDVSWQEYPMAHQVCAEELQAIRHWLIARL
FT                   S"
     atggcaatca tcgttatgag tttagagttt gtagaatatc cggctcaagg tgagcataaa        60
     gcaaccgtta tttggttgca cggtttaggt gattcggggg aaggttttgc acccgtagca       120
     ccacagttac aattaccaaa tgaactaggg ctgcgattta tttttccgca cgcgcctgta       180
     caaccggtca ccataaatgg tggcatggaa atgcgttctt ggtatgatat taaatcaata       240
     gaattagata aacgtgccga tgagcaaggt gtaagagatt ctgccgctaa agtagagcaa       300
     cttattaacc aagaaatagc caatggtatt gctgctgata aaattatttt agcgggtttt       360
     tcccaaggtg gcgttgtagc tttgcattta gccccacgtt ttgagcaaaa gctggcgggt       420
     gtaatggcgc tttcaaccta tatgtgtgta ccagaaaagc tggcagatga agcactacac       480
     acagatttaa atatttttat ggcgcatggc agtcaagata atgtagtacc gcctagtgca       540
     ggtaaaagtg cgttcgaagt attaacagca cttagcatgg atgtaagctg gcaagagtac       600
     cctatggctc accaggtttg cgcagaagaa ctgcaagcta ttcgccattg gttaattgct       660
     cgcttaagct aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page