(data stored in ACNUC7421 zone)

EMBL: CR954246.PE92

CR954246.PE92        Location/Qualifiers
FT   CDS_pept        98339..99244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0097"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85206"
FT                   /db_xref="GOA:Q3IF66"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF66"
FT                   /protein_id="CAI85206.1"
FT                   /translation="MSQKIVIKANVKREPQESVTTLTYEWNWRRIVSISMLLLMTSAAV
FT                   IYGLTSAVSAEQDEHPNEPEDRVLAQSNDISQRAVTSLQTTQVELNTSATVASQNSESE
FT                   LLVAPINLVAEQKVAEPDKVAAAELPVIPQAEIKNNSPEPVNIEQVPTTDLLVDTDVAA
FT                   ISDTALSSTQGFAPLAQLASVALGAQIDTDKISRAVLTRKVSKREPVNVFAADIRLSQF
FT                   DETLSFFSELKNLQGQQVKHVWFFEDDIVAEIELDITSSRYRTYSTKNIMDSQIGQWRV
FT                   DVIDEQGQLIAQKEFRILAD"
     atgagtcaaa aaatagttat taaagcaaat gttaaacgcg aaccacaaga aagtgtaact        60
     acactaacct acgagtggaa ttggcgtcgt attgtgagta tttctatgct gctactcatg       120
     acctctgctg ccgttatata tggcttaacc agtgccgtta gtgccgagca ggatgaacac       180
     cccaatgagc cagaggatag agtgttggcg caaagtaacg atataagcca gcgtgctgtt       240
     acttcattac aaacaacgca agtagagcta aatacctcgg caacagttgc gtcacaaaac       300
     agtgaaagtg agttgttagt tgcgcctatt aatttagttg cagagcaaaa agtagcagag       360
     cctgataaag tagcagcggc agagttaccc gtaatcccgc aagctgagat taaaaacaac       420
     tcaccagagc cggttaatat tgagcaagta cctactaccg atttattagt tgatacagat       480
     gttgccgcta ttagtgatac tgcactctct agcacgcagg gctttgcccc tttagcgcag       540
     ctagcgagtg tggcacttgg cgcgcaaata gataccgata aaataagccg agcagtgctt       600
     acacgtaaag taagcaagcg agagccggta aatgtatttg ctgcagatat tcgtttaagt       660
     caatttgacg agacgttatc gttttttagt gagctaaaaa acttacaagg ccaacaggta       720
     aagcatgtat ggttttttga ggatgatatt gtggctgaaa ttgagttaga tataacatcc       780
     tctcgttatc gtacgtattc gaccaagaat ataatggact cgcaaatagg ccaatggcgg       840
     gttgatgtaa ttgatgagca aggccaatta attgctcaaa aagaatttag aatattagct       900
     gattga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page