(data stored in ACNUC7421 zone)

EMBL: CR954246.PE96

CR954246.PE96        Location/Qualifiers
FT   CDS_pept        103222..105912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0101"
FT                   /product="putative sensor protein; similar to LuxQ in
FT                   Vibrio harveyi, similar to ArcB sensor in E. coli"
FT                   /function="1.3.1 : Sensors for chemicals"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85210"
FT                   /db_xref="GOA:Q3IF69"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF69"
FT                   /protein_id="CAI85210.1"
FT                   /translation="MKGLFKLSFSLACAYFITGYFSNLLLAIDGFAVASWPPAGIAVAS
FT                   FLLWGRKSFLGIFVGALLTSLIHLDNVVDILNWQVFFQAAAIAIAVVFQAWLGAQIIIK
FT                   VIKAPLDLSSLKHSVQSLIIAGPVCCIIGASVGTSLLVFNNIIAQHAALDSFIAWWIGD
FT                   SIGVLIFTPLMLAAFNYSVMRYRLQVILPSLLIYILISVSFYGAASVKKEKNIQKQEIK
FT                   TLAVQDSITHKLDEISAHLALLATFFSSSEDVNFKEFRQFTAKQLSYSEEILAFEWVPY
FT                   VPKSALLEYQQMTQLADVEHFFVKEKSPTNQWQAVAERDVYYPIRYAYPLKGNEDAIGF
FT                   DLASNDFMQEALNKSKTLNEMVISQPVKLVQNQAELGVLFLHPVFGSMETEDDFKGFAV
FT                   AVVSLKKLSQSLLFDHENLVTASFLDINNTNNTHAIYIANNESMDLLKSYQLLIGNRMW
FT                   QVELHEPLVTTSWLIYWLAQIVGMLFVWLLVAFLISVTGTNVQIREQVARQTRTLRQEK
FT                   QKADEASQIKSQFLANMSHEVRTPINGIKGLHYLALQQNDWQQARTYIEQADGALGVLL
FT                   RVLNDLLDFSKMEAGKLDLMQEPVDIGRLAEEVINLIQFEVSVKSLEIKLDYDKNTNLM
FT                   INTDAIRLKQVLLNLLNNAVKFTAQGSITLKIWQSKTMTYLSVSDTGIGISKEAQKKLF
FT                   RPFAQADNSTSRQYGGTGLGLSICKKLVELMGGAIDLKSTAGQGSTFTFSLPLNSPLPK
FT                   VEKSEQSFSDVDIENVSFANSAVLLVEDNPLNQHVATAILKTKGCVADIANDGFAAIEM
FT                   LTEKSYDIVLMDIQMPKMDGLQATKVIRNELGLLDLPIIGLSANAHDDDVKKALACGMN
FT                   SYITKPIDANILFKALWHYLAAIEK"
     atgaaaggtt tgtttaaatt gtcttttagc ttagcttgcg cttactttat tacaggctat        60
     tttagtaatt tattgcttgc tatagatggt ttcgctgtgg cttcttggcc ccctgcgggc       120
     atagctgtag caagcttttt gttatggggc cgtaagtctt ttttaggtat ttttgttggt       180
     gcattactta ctagcttaat tcaccttgat aatgttgttg atatattaaa ctggcaagtt       240
     tttttccaag ctgctgcaat tgctatcgct gttgtttttc aagcatggct tggcgcgcaa       300
     ataataatta aagttattaa agcccccctc gatttatcgt cactaaaaca tagtgtacaa       360
     agcttaatta tagccggccc tgtatgttgt attattggtg ctagtgtcgg caccagctta       420
     cttgttttta ataatataat tgctcaacat gccgcgctag atagttttat tgcgtggtgg       480
     attggcgaca gtattggggt gctcattttt acgccattga tgctggctgc atttaattac       540
     tcagtgatgc gataccggct acaagttatc ctgccttctt tacttattta cattcttatt       600
     agtgttagct tttatggtgc tgccagtgtt aaaaaagaaa aaaacattca aaaacaagag       660
     ataaaaacat tagctgtaca agactcaatt actcataaat tagatgaaat ctctgcacac       720
     ttggctttac tggctacttt tttttcgagc agtgaagatg tgaactttaa agagtttcgg       780
     caatttacgg caaaacagtt aagctacagc gaagaaatat tggcgtttga atgggtaccg       840
     tatgttccta aaagtgcgct gttagaatat caacaaatga cgcaactagc cgatgttgaa       900
     catttttttg taaaagaaaa atcaccaacc aaccaatggc aagccgttgc tgagcgagat       960
     gtatattatc caattaggta cgcataccca ttaaaaggca atgaagatgc tattggcttt      1020
     gatttagcat caaacgactt tatgcaagag gcattaaata agtcaaaaac gcttaacgaa      1080
     atggtcatta gccaaccggt taagttggtg caaaaccagg ctgagttagg ggtgttattt      1140
     ttgcatcctg tatttggaag tatggagact gaagatgact ttaaaggttt tgccgttgcg      1200
     gtagtgagct taaaaaaact atcgcagtcg ttgctttttg atcatgaaaa cttagttaca      1260
     gcaagctttt tagatattaa caataccaat aatacccacg ctatttatat tgccaacaac      1320
     gagtcaatgg acttgttaaa gtcctaccag ctactcattg gtaaccgtat gtggcaggtt      1380
     gagttgcacg agcccttagt tacaacctcc tggttaatat attggttggc acaaatagtg      1440
     gggatgctgt ttgtttggtt actggtagca tttttaattt ctgttacagg cacaaatgtt      1500
     caaatacgcg agcaagttgc taggcaaacg cgcacattac gccaagaaaa gcaaaaagct      1560
     gatgaagcga gtcaaataaa aagccagttt ttagcgaata tgagccacga agtgcgcacg      1620
     ccaattaatg gtattaaagg cttacactac ttagcgttac aacaaaatga ttggcaacaa      1680
     gcccgtactt acatagagca agctgatggt gcgttagggg tgttacttag agtattaaat      1740
     gacttactcg atttttctaa aatggaggca ggtaaacttg atttaatgca agaacccgta      1800
     gatatagggc gcttggctga agaggtaatt aacttaatac aatttgaagt aagtgttaag      1860
     tcgttagaaa taaagctaga ttacgataaa aatacaaact tgatgattaa caccgatgct      1920
     attcgtttaa agcaagtgtt actaaattta ctcaataatg cggttaaatt tactgctcaa      1980
     gggagtatta cactgaaaat ttggcaatcg aaaaccatga cctatttaag tgtaagcgat      2040
     acaggtattg gtattagtaa agaggcacaa aagaaattat ttaggccttt tgctcaagca      2100
     gataactcta cgtcacgcca atatggcggt acagggttgg gcctcagtat ttgtaaaaag      2160
     ctagttgagc ttatgggtgg cgctatagat ttaaaaagca ctgcagggca aggttcaaca      2220
     tttaccttta gtttaccgct taactcccct ttacctaaag tagagaaaag tgagcaaagc      2280
     tttagtgacg tggatataga aaacgtatca tttgcgaaca gcgcagtact tttagttgag      2340
     gataacccgt taaaccaaca tgtagccact gccattttaa aaaccaaagg gtgtgttgct      2400
     gatattgcta atgatggctt tgccgcaatt gaaatgttaa ctgaaaaaag ttacgacatt      2460
     gtccttatgg acattcaaat gcccaaaatg gacggcttac aagcaaccaa ggtaatacgt      2520
     aatgagctag gcttattaga tttgcctatt ataggtttat cggctaatgc ccatgatgac      2580
     gatgttaaaa aagcgcttgc ctgtggaatg aatagctata taacgaaacc aatagatgcg      2640
     aatattttgt ttaaagctct ttggcattat ttagcggcga tagaaaaata a               2691
//

If you have problems or comments...

PBIL Back to PBIL home page