(data stored in ACNUC7421 zone)

EMBL: CR954246.PE98

CR954246.PE98        Location/Qualifiers
FT   CDS_pept        complement(107138..107548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0103"
FT                   /product="conserved protein of unknown function ; could be
FT                   a dehydrogenase; putative inosine binding site"
FT                   /function="5 : Similar to unknown proteins"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85212"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF67"
FT                   /protein_id="CAI85212.1"
FT                   /translation="MLNTKVKDFMQHKLPNITPDTEMTTAIAELQKFKLLGAPVFDSNK
FT                   FLVGFISEQELLKPLMQSSYFCDGVVKVSQLMQTEVVTVNGDTNIIELAEQMRPGKPKN
FT                   YPVVDGEKVIGMISRADILKALYDNYLACQTH"
     atgctaaata caaaagtaaa agactttatg caacacaagt tgccaaacat taccccagat        60
     accgaaatga ccactgccat tgcagagctg caaaaattta aattacttgg tgccccagta       120
     ttcgatagca ataaattttt agttggcttt atctctgagc aagagctgct taaaccactc       180
     atgcaaagca gttatttttg tgatggggtg gtgaaagtat cgcaactaat gcaaacagaa       240
     gtcgtgactg taaatggcga caccaacatt attgaacttg ctgagcaaat gagacccggt       300
     aaaccgaaaa attaccctgt ggttgacggc gaaaaagtaa taggaatgat cagcagagcc       360
     gatattctca aagcccttta cgataactac ctagcttgtc aaacacacta a                411
//

If you have problems or comments...

PBIL Back to PBIL home page