(data stored in ACNUC7421 zone)

EMBL: CR954246.PEPP

CR954246.PEPP        Location/Qualifiers
FT   CDS_pept        582543..583865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="PSHAa0562"
FT                   /product="proline aminopeptidase P II"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.11.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2659585, 2851590; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85649"
FT                   /db_xref="GOA:Q3ILI4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI4"
FT                   /protein_id="CAI85649.1"
FT                   /translation="MVEIQKSEFKARRERLLAKMDSNSVAIIPAASEVTRSRDTHYAFR
FT                   QDSDFFYLTGFNEPDAVLVLAPNSDTPSTLFCLNKDKLAEVWHGRRIGFEKAKNEYLFD
FT                   ATHELSELSEQLFNLLNGKAVLYYAQGAYSAFDGRVFSLLNTLRSAPKKGDTAPSTIKD
FT                   IRLLIHEMRLFKSPSEINIMRAGCEISAQGHVRAMCFAHSGATEYQLEAELHHHYAMHG
FT                   ARHPAYGTIVGSGDNANILHYTQNSDALKSGDLVLIDSGCELQGYAADITRTFPVNGKF
FT                   SPEQAALYNIVLKAQEVAFAEIKPGGYMSHANALAMAVMTQGLLDLGILTGDFNELMAK
FT                   QACKEYYMHGLGHWLGLDVHDVGDYKQNNSERAFAAGMVLTIEPGLYISEDSNAPQKYR
FT                   GIGIRIEDNLLVTPSGYENLTLSAPKTISDIEALMQSNKSA"
     atggttgaaa tacaaaagtc agagtttaaa gcacgtcgtg agcgtctgct tgcaaaaatg        60
     gatagtaaca gtgtggcaat tatacctgcg gcgagcgaag ttacgcgcag ccgcgacact       120
     cactatgcat ttaggcaaga cagtgacttt ttttacttaa ctggttttaa tgagcccgat       180
     gccgtacttg tacttgctcc aaatagcgat acccccagta cattattttg ccttaataaa       240
     gataaactag ccgaagtatg gcatggccgt agaataggct ttgaaaaagc aaaaaacgaa       300
     tatttgtttg atgcaaccca tgaattaagt gagttgagtg aacagttatt taatttgctc       360
     aatggcaaag cggttttata ttatgcgcaa ggtgcatatt cggcttttga tgggcgtgtt       420
     ttctctttgc ttaatactct gcgcagcgcc cctaaaaaag gtgacacagc gccaagtacc       480
     attaaagata ttcgtttgtt aattcacgaa atgcgtttat ttaaatcacc aagtgaaata       540
     aacattatgc gcgcaggctg cgaaattagc gcgcaaggcc atgttagagc aatgtgtttt       600
     gcccatagcg gtgcaaccga gtatcaatta gaagcagagc tacatcatca ttatgcaatg       660
     catggtgcgc ggcacccagc gtatggcact attgttggta gtggcgacaa tgctaatatt       720
     ttacattaca cccaaaacag cgacgccctt aaaagtggcg atctagtgtt aatagattca       780
     ggttgcgagc tacaaggcta cgctgctgat attacacgta catttccagt gaatggtaaa       840
     tttagccccg agcaagccgc gttatataat attgttctta aagcgcaaga agtggcgttt       900
     gcagaaatta aacccggcgg ttatatgtcg catgctaatg ctttagcaat ggcagtaatg       960
     acccaaggtc tactagattt gggtatttta accggcgact ttaatgagtt aatggcaaag      1020
     caagcctgta aagaatatta catgcatggt ttggggcatt ggttaggcct agacgtacat      1080
     gatgtaggcg actacaagca aaacaatagc gaacgcgcat ttgctgcggg catggtttta      1140
     accattgagc ctgggcttta tatcagcgaa gattcaaatg caccgcaaaa ataccgaggt      1200
     attggtattc gcattgaaga taacttatta gtaaccccaa gtggttatga aaacctcacc      1260
     ctaagtgcgc caaaaaccat aagcgatata gaagcactta tgcaaagcaa taaaagcgca      1320
     taa                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page