(data stored in ACNUC7421 zone)

EMBL: CR954246.PEPQ

CR954246.PEPQ        Location/Qualifiers
FT   CDS_pept        17005..18327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="PSHAa0013"
FT                   /product="Xaa-Pro proline dipeptidase"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.13.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6336737, 372108; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85127"
FT                   /db_xref="GOA:Q3IJ21"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ21"
FT                   /protein_id="CAI85127.1"
FT                   /translation="MDKLAVLYAEHIATLQQRTRTICEREGLEGLVIHSGQAKRQFLDD
FT                   MYYPFKVNPHFKAWLPVLDNPHCWIVVNGSDKPKLIFYRPVDFWHKVPDEPRDFWAEYF
FT                   DIELLLQPDQVEKLLPYDKANYAYVGEYLEVAQALGFSVMNPEPVLNYFHYHRAYKTQY
FT                   ELECLRNANRIAVDGHKAARDTFFNGGSEFDIQQAYLMATRQSENEMPYGNIVALNENC
FT                   AILHYTHFEAKAPQQHNSFLIDAGANFNGYAADITRTYDFKKQGEFAELVQAMTAAQIE
FT                   LGTGLKPGMLYGDLHVECHNRVAQILSDFDIVKLPAEEIVERKITSTFFPHGLGHHLGL
FT                   QVHDMGGFMADEMGAQQAAPEGHPFLRCTRIIEKNQVFTIEPGLYFIDSLLGDLAQTDN
FT                   KQFINWQKVESFKPYGGIRIEDNIIVHEDSLENMTRNLALD"
     atggataaat tagccgtttt atacgccgaa catattgcaa cactgcaaca acgtactcgt        60
     acaatttgtg aacgtgaagg gttagaggga ttagttattc actcgggcca agctaagcgt       120
     cagtttttag atgatatgta ttatccgttt aaagttaatc cacactttaa agcttggtta       180
     ccagtactag acaatccaca ttgctggatt gtggtaaatg gtagcgacaa gcctaaactt       240
     attttttatc gtccggttga tttttggcat aaagtgccag atgagccgcg cgatttttgg       300
     gctgagtatt ttgacattga attgttatta cagcccgatc aggttgaaaa gctattgccc       360
     tacgacaaag ctaactacgc ttatgtgggc gaatacttag aagtagcaca agcactaggc       420
     tttagtgtta tgaatcctga gccggtacta aattactttc attaccaccg cgcttataaa       480
     acccaatatg agcttgaatg tttacgcaac gccaaccgta ttgcagtaga tggccacaaa       540
     gctgcccgcg ataccttttt taatggtggc agtgagtttg atattcagca agcttactta       600
     atggcaactc gccaaagtga aaacgaaatg ccttatggca acattgtggc gctaaacgaa       660
     aactgcgcca ttttgcacta cacgcacttt gaggcaaaag caccgcagca acacaactca       720
     tttttaatag atgcaggcgc taattttaat ggctatgcgg cagatattac ccgtacgtat       780
     gactttaaaa aacaaggcga atttgcagag ctagtgcaag caatgactgc agcgcaaata       840
     gagttaggta cggggttaaa acccggcatg ctttatggtg atttacatgt tgagtgtcac       900
     aatagagttg cacaaatact tagcgacttt gatattgtta agctaccggc tgaggaaata       960
     gttgaacgta aaattacctc taccttcttc ccacatggtt tagggcatca cctaggttta      1020
     caagtgcacg acatgggtgg ttttatggct gatgaaatgg gcgcacaaca agcagctcca      1080
     gagggacatc catttttgcg ttgtactcgc ataattgaaa aaaaccaagt gtttactatt      1140
     gagcctgggc tatactttat cgactctttg ctaggcgatt tagcacaaac cgataataaa      1200
     cagtttatta attggcaaaa ggtagagtcg tttaagcctt atggtggtat tcgtattgaa      1260
     gataacatca tagtacacga agatagcctt gagaatatga cacgaaattt agcgctagat      1320
     taa                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page