(data stored in ACNUC7421 zone)

EMBL: CR954246.PILB

CR954246.PILB        Location/Qualifiers
FT   CDS_pept        complement(393375..395048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilB"
FT                   /locus_tag="PSHAa0378"
FT                   /product="type IV pilus biogenesis protein PilB"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1971619"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85476"
FT                   /db_xref="GOA:Q3IID2"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID2"
FT                   /protein_id="CAI85476.1"
FT                   /translation="MNINSPLLRKFITLGRVDADIVKTKQQEFASTAELIAKCGKIDSK
FT                   DLAAQCIDLFRVPFFDLKDFNTALISPELIKEKLIRKHHILPLVQKGRKVYIAASDPTD
FT                   YGAFENFEFSTGLSCEVVVVDYIQLDKKIEQLLDATGSLNLSDDEFKEFAELDADIQKD
FT                   TTKDDDKDDAPIIVYINKILMDAIKKGASDLHFEPYEHKYRIRFRIDGILHEVASPPNS
FT                   LATKLSARIKVMSRLDIAEKRKPQDGRIKLKITERKSVDFRVSTMPTLWGEKIVMRILD
FT                   SSSAMLGIDVLGYEPEQKKLYMDALEQPQGMILVTGPTGSGKTVSLYTGLNILNQPERN
FT                   ISTAEDPVEINLEGVNQVQINIKADMTFANALRAFLRQDPDVVMVGEIRDLETAEISIK
FT                   AAQTGHLVLSTLHTNSAPETITRLLNMGVPAYNVASSISLIIAQRLARRLCPKCKTPEN
FT                   LPSEELLRQGFSQQQISEMTLYAPKGCENCTDGYKGRVGIYEVMKITPEIAQIIMRGGN
FT                   SLEIAEVSLKAGFNNLRLSGIRKAADGMTSLAEINRVTSF"
     atgaatatta actcaccgtt attaagaaaa tttattaccc ttggccgtgt tgatgccgat        60
     atagtaaaaa ctaaacagca agagtttgcc tctactgctg agcttattgc taaatgcgga       120
     aaaattgaca gtaaagattt agcggcgcaa tgcattgatt tatttagggt gccttttttt       180
     gatttaaaag actttaatac tgcacttatt tctcctgagt taataaaaga aaaactgatc       240
     cgtaagcatc atattttgcc tttagtacaa aaaggcagaa aagtgtatat tgccgcctct       300
     gatcctaccg attacggcgc atttgaaaac tttgaattta gtactggttt gtcttgcgaa       360
     gtggtagtgg ttgactacat tcaactcgat aaaaaaatag aacaattgct tgatgccact       420
     ggcagcttaa atttaagtga tgacgagttt aaagagtttg ccgaactaga cgccgatata       480
     caaaaagaca ccactaaaga cgatgacaaa gacgatgcgc caatcattgt ttacatcaat       540
     aaaatattaa tggatgcgat taaaaaaggt gcgtctgatt tacactttga accctacgag       600
     cacaagtacc gaattcgttt tagaattgac ggtattttgc acgaagtagc cagcccacca       660
     aacagtttag ctactaagct ttcggcgcgt attaaagtaa tgtcgcgcct tgatattgcc       720
     gaaaaacgta aaccacaaga tggccgcata aagctaaaaa taaccgagcg taaaagtgtc       780
     gattttcggg taagcaccat gcccacttta tggggcgaaa agattgtaat gcgtattctt       840
     gattcatcta gcgccatgct tggcattgat gtattaggtt acgaacccga gcaaaaaaag       900
     ctgtatatgg atgcgcttga gcaaccacaa gggatgatat tagtaactgg gcctactggc       960
     tcgggtaaaa cggtatcgct ttacaccggc ttaaatatat taaaccagcc tgagcgtaat      1020
     attagtaccg ccgaagatcc ggtagaaatt aacctcgaag gggttaacca agtacaaatt      1080
     aatattaaag ccgatatgac ctttgccaac gcattgcgcg catttttacg ccaagatccc      1140
     gatgtagtaa tggtaggtga aatacgtgac ctagaaaccg ccgaaatatc aattaaagcg      1200
     gcgcaaacag gtcacttagt gctttcgacc ttgcatacta actcggcgcc cgaaaccatt      1260
     acccgtttat taaacatggg cgtaccggca tataacgtag caagttcaat tagtttaatt      1320
     atagctcagc gcctagcgcg ccgcttatgc cctaaatgta aaacacctga aaatttacct      1380
     agcgaagaac tgctacgcca aggctttagc cagcaacaaa ttagtgaaat gaccctgtat      1440
     gcacctaaag gttgcgaaaa ctgtaccgat ggctataaag gtcgtgtagg tatttacgaa      1500
     gtaatgaaaa ttaccccaga aatagcacaa attataatgc gcggtggtaa ctcactagaa      1560
     atagctgaag tgtcgcttaa agccggattt aataacctgc gtttatcggg tattcgtaaa      1620
     gccgccgacg gcatgacctc gctagccgag attaatcggg taacgagttt ttaa            1674
//

If you have problems or comments...

PBIL Back to PBIL home page