(data stored in ACNUC7421 zone)

EMBL: CR954246.PILC

CR954246.PILC        Location/Qualifiers
FT   CDS_pept        complement(396727..397953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="PSHAa0381"
FT                   /product="type IV pilus biogenesis protein PilC"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1971619; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85479"
FT                   /db_xref="GOA:Q3IIC9"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC9"
FT                   /protein_id="CAI85479.1"
FT                   /translation="MAKQQEKKGQDTFEWVGVSTRGKRLEGELTGSSVALVKAQLRKQG
FT                   ITPSKVKRKAKPLFGARLQKITPKDIAIVTRQIATMLMAGVPLIQSIEMIGTGATNKSL
FT                   GKLMETIADEVKAGQPLSQALRRHPRYFDDLYCDLVASGEQSGALDKIFDRVAIYKEKS
FT                   EALKSKIKKAMFYPIAVLVIALIVTSILLIFVVPQFQDIFAGFGAELPAFTLFVISISE
FT                   FMQAYWWIILIIMFAFGWAFKEAHLKSLKLRDATDRAILKLPVIGMILNKAAVARYART
FT                   LSTTFAAGVPLVDALDSAAGASGNAVYRYAILEIKAEVSSGNQMNWAMRNSKIFPDMVI
FT                   QMVAIGEESGSLDGMLGKVATIYEQEVDDAVDGLSSLLEPMIMAVLGVLVGGLIIAMYL
FT                   PIFQLGSVI"
     atggctaaac aacaagaaaa aaaagggcaa gatacctttg agtgggtagg cgttagcact        60
     cgcgggaaac gcttagaagg tgagcttact ggttctagtg ttgcgttagt aaaagcccaa       120
     ctgcgtaaac agggtattac cccctcaaaa gtaaagcgta aagccaagcc gttatttggt       180
     gcacgcttac aaaaaatcac ccctaaagat attgccatag tcactcggca aattgccacc       240
     atgcttatgg caggtgtacc gctaatacag tcaattgaaa tgattggtac cggagcgact       300
     aataaaagcc ttggtaaact catggaaacc attgctgatg aagtaaaggc tggccaaccg       360
     ttatcgcaag cactgcgacg ccacccccgt tattttgatg atttatattg cgatttagtg       420
     gcatcgggtg aacaatctgg cgctttagat aaaatattcg accgcgtggc tatttataaa       480
     gaaaagtctg aagcgcttaa atcaaaaatt aaaaaggcga tgttttatcc tattgcggta       540
     ttagttatcg cacttatagt tacctcaata ctactaatat ttgtagtacc gcaatttcag       600
     gatatttttg ccggctttgg cgctgaactc cctgctttca ccttatttgt aattagcata       660
     tcggaattta tgcaggcgta ttggtggata atacttataa taatgtttgc ctttggttgg       720
     gcgtttaaag aagcgcacct taaaagctta aagctgcgcg atgctaccga ccgagccata       780
     ttaaagttgc cagttattgg tatgatttta aataaagccg ccgttgcgcg ttatgcccgt       840
     acgctctcta ccacctttgc tgctggtgta ccgctagttg atgcgctgga ttctgccgca       900
     ggcgcctcgg gtaatgcggt ttatcgttat gctattttag aaataaaagc cgaagttagc       960
     tcgggtaacc aaatgaactg ggcaatgcgt aactctaaaa tattccctga tatggtaata      1020
     caaatggtgg ctattggtga agagtcaggc tcgctcgatg gcatgctagg taaggtagcg      1080
     actatttatg agcaagaagt tgatgatgca gtagatggac tatcaagcct attagagccg      1140
     atgattatgg cagtactagg cgtgctagta ggtggtttaa ttattgccat gtacttacct      1200
     atattccaac ttggctctgt tatttag                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page