(data stored in ACNUC7421 zone)

EMBL: CR954246.PILD

CR954246.PILD        Location/Qualifiers
FT   CDS_pept        complement(395803..396678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilD"
FT                   /locus_tag="PSHAa0380"
FT                   /product="Type 4 prepilin-like proteins leader peptide
FT                   processing enzyme"
FT                   /function="3.3.6 : Protein modifications"
FT                   /EC_number="3.4.23.43"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1971619, 9224881; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85478"
FT                   /db_xref="GOA:Q3IID0"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID0"
FT                   /protein_id="CAI85478.1"
FT                   /translation="MQSQLWFYLTTIGLVSLCVGSFLNVVIYRLPLMMQHEWQGECRLL
FT                   LESELKGNKADESESLNSTFNLVKPNSTCPKCKTAIKAWQNIPVVSWLFLKGKCASCSN
FT                   PISARYPIVEAITALLSLVVAYKLGATEQALLYIAITWALVALTFIDIDHMLLPDQITL
FT                   PLVWLALIAAVLGYTVTPTDAIIGAACGYLSLWSVFWLFKLLTGKEGMGYGDFKLLAVF
FT                   GALLGWQSLLTIILLSSVVGAIIGIALLTIQGKDKATPIPFGPYLAIAGWITMLWGEQL
FT                   QTSYFNLIGY"
     atgcaaagcc aattgtggtt ttatttaacc actattggct tggtgagttt gtgtgttggc        60
     agttttttaa acgtagttat ttaccgtttg ccactaatga tgcaacacga atggcaaggc       120
     gaatgccgct tgctgttaga aagtgaactt aaaggtaata aagcagatga aagcgagtct       180
     ttaaactcaa cttttaattt agtaaagccc aactctacct gccctaaatg taaaacagca       240
     attaaagcgt ggcaaaatat acccgtagtt agctggttat ttttaaaagg taaatgcgcc       300
     agttgtagta acccgatatc ggctcgctat cctattgtag aggcaataac tgcactatta       360
     agcttagtgg ttgcgtataa gctgggcgct accgagcagg ctttacttta tatagcaatt       420
     acttgggctt tagtggcact tacctttatt gatattgacc atatgttact gcccgaccaa       480
     attaccctac cgcttgtatg gctggcactt attgcagcag tactgggcta taccgttacc       540
     ccaactgatg ccattattgg tgcagcttgc ggctatttaa gtttgtggag cgtattttgg       600
     ttatttaaat tacttaccgg taaagaaggc atgggctatg gcgactttaa attacttgcc       660
     gtatttggtg ctttgcttgg ctggcaatca ctattaacca ttattttgct ctcgagcgta       720
     gtgggcgcaa ttattggcat tgcgctatta actattcagg gtaaagacaa agccacgccc       780
     attccgtttg gcccctacct tgctattgca ggctggatca ccatgttatg gggcgagcaa       840
     ttgcaaacta gctactttaa tttaattggc tactaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page