(data stored in ACNUC7421 zone)

EMBL: CR954246.PLDA

CR954246.PLDA        Location/Qualifiers
FT   CDS_pept        complement(183849..184883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pldA"
FT                   /locus_tag="PSHAa0175"
FT                   /product="putative outer membrane phospholipase A
FT                   precursor"
FT                   /function="1.1.2 : Biosynthesis and degradation of surface
FT                   polysaccarides and lipopolysaccharides"
FT                   /EC_number="3.1.1.32"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85278"
FT                   /db_xref="GOA:Q3IJ39"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ39"
FT                   /protein_id="CAI85278.1"
FT                   /translation="MSWRYLIILSTLVSTTVFAEEKPKNNEQNSNIELVKQCILNEVIG
FT                   GDGKQTLDQLRKKCSALEEDKQLTAIDKRKAREAVSQKNRNVITPHKRNYILPISYVSH
FT                   PNNSSFETFDELTGEKNDEPLDNLEAKYQLSIKVPLFNDFSDKDQAIFFAFTLQSYWQL
FT                   YNKESSSPFRETNYEPEVFWVNYLDPEHVPWGDEMAVVLGISHQSNGNSQPNSRSWNRI
FT                   YANFIWEKNGFVFNFKPWYRISESEKETPLDPRGDDNPDIYKYMGYFEFSGAYRLNEHE
FT                   FSFMTRNNLNSDNRGALQLDWSFPLWGRVRGYAQYFNGYGESLIDYNADIERIGVGILL
FT                   TDLL"
     atgagctggc gatacttgat catactttca acattagtta gtactactgt ttttgctgaa        60
     gaaaaaccta aaaacaatga gcaaaatagt aatattgagc tggtaaaaca atgtatttta       120
     aatgaagtga ttggtggaga cggcaagcaa acactcgatc agcttcgtaa aaagtgctcc       180
     gctcttgaag aagataagca acttaccgcc atcgataagc gcaaagcacg agaagcagta       240
     agccaaaaaa accgtaatgt tattacgcca cataaacgta actacatttt acctatttcg       300
     tatgtatcgc atccgaacaa tagctcgttt gaaacattcg acgagctaac aggcgaaaaa       360
     aatgacgagc cactcgataa cttagaagcc aaatatcagc tttcaattaa agtgcctcta       420
     ttcaatgact tttcagataa agaccaagct atattttttg cctttacact acagtcatat       480
     tggcagcttt ataacaaaga aagctcatca ccatttcgtg agaccaacta cgagccagag       540
     gttttttggg ttaactattt agatccagaa cacgttcctt ggggcgacga aatggctgtt       600
     gttttgggta tttcgcatca atctaacggt aatagtcagc caaattcacg ttcatggaac       660
     cgtatttacg ctaactttat ttgggaaaaa aatggctttg tgtttaactt taagccttgg       720
     tatcgtattt cagaaagcga gaaagaaaca cctttagatc caagaggcga cgacaaccct       780
     gacatttaca aatacatggg ttactttgag tttagcggtg cgtatcgcct taatgaacat       840
     gaatttagct ttatgacccg taacaactta aattcagaca atcgcggtgc attacagctc       900
     gattggtcat ttccgctttg gggccgagtg cgtggttatg cacagtactt taatggctat       960
     ggcgaaagct taattgatta taacgctgat atagaaagaa ttggcgtagg tatactactt      1020
     accgatttac tttaa                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page