(data stored in ACNUC7421 zone)

EMBL: CR954246.PLSB

CR954246.PLSB        Location/Qualifiers
FT   CDS_pept        complement(153368..155806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="PSHAa0142"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="2.3.1.15"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7929384, 10231527; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85246"
FT                   /db_xref="GOA:Q3IF27"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF27"
FT                   /protein_id="CAI85246.1"
FT                   /translation="MRIVNYCLNVLSAGVSRLLVRSKVLPEKPTEQYELNSKNPTFYIV
FT                   RLNSRFDLAALARVCKRHGLPDPREQQVLGTQRLDRFIGIENPPPLIGDIAKPTNALAQ
FT                   GKQIIDHLLSSGQKDVQVIPVTILWGRAPGKEKPGLSTLITHSLTPSWFRKLFVVLFSG
FT                   RDNFIRFSQPLDLSLLVDEKADVNELPQKLLRVARVHFRRQKLAATGPKMPSREQLFNS
FT                   LLASPTIKKAIQDEAKAKNISQAQARQNAVKLLNEIAANYSEAMIRVAERFLTWLWNKL
FT                   YNGIDIKYTEQIHELTNKGHEIIYMPCHRSHMDYLLLTYAIYHQGLVPPHIAAGINLNF
FT                   FPAGGIFRRSGAFFIRRSFAGNKLYSAVFKEYLSQLFIKGYSVKFYTEGGRSRTGRLLP
FT                   PKTGMLAMTMQAMLRGIDRPISIVPVYIGYEHVMEINTYLKELAGNDKKGESIFGIFKA
FT                   IKNLKNYGRGYLNFGDPISINQYLNDNQPNWRDDIHPTDVQKPQWLGPQVANLADQVMV
FT                   KINNAAALNAVNLLAMILLVNDKHALSKPKLLAQLDFYLRLQRDASYSNKVTAPEETPE
FT                   QLLTHALKLNKFDVISDEFGEIIAINDKEKTLFNYYRNNILHLFAVPSLIALHLFREKT
FT                   TTVSKCQQLVAAFYPLFAKEWYLRELDEDYITRILANFVDQNLIELDGDNIHITNTNDC
FT                   LAKLDMLGKALNFTLQRYAIVIGFIQTSNGIEKAELERESQVLAQRLGTLHGIKTPEFF
FT                   DKKVLVSFIDNLRAQSLITDGDAGLIGSVQLCETYMHLKALLPARVWQSISDIVQGQCK
FT                   "
     atgcgtattg taaattattg cttaaatgtt ttatcagctg gagtaagccg cttacttgta        60
     agaagtaagg tactgccaga aaagccgact gaacaatatg aattaaactc taaaaaccct       120
     accttttata ttgtgcgctt aaactctcgc tttgacttag cggcgcttgc tcgggtatgt       180
     aaacgccatg gattacccga tcctagagaa caacaagtat taggcacaca acgcttagac       240
     cgctttatag ggattgaaaa cccaccacca ttaattggtg atatagcaaa gccaactaat       300
     gcactagcgc aaggcaaaca aattattgat cacttattaa gtagtggtca aaaagatgta       360
     caggttattc ctgttactat tttatggggc cgagcgcccg gcaaagaaaa gcccggactt       420
     agcacgctca taacacactc attaacacca agttggttta gaaagttatt tgtggtgttg       480
     ttttctggcc gagataactt tatccgcttt agccaaccac tcgacttatc acttttagta       540
     gacgaaaaag cggacgttaa cgagcttcca caaaaactat taagagtagc ccgcgtgcac       600
     tttcgccgcc aaaaacttgc cgcaacaggc cctaaaatgc catcgcgcga gcagctattt       660
     aactcattat tagcctctcc aacaataaaa aaagccatac aagacgaagc aaaagctaaa       720
     aatattagcc aagcgcaagc acgtcaaaat gcggttaagt tacttaatga aatagcggct       780
     aactattcag aggcaatgat acgcgtagct gagcgctttt taacttggct gtggaataag       840
     ctatataacg gtatagatat aaaatacaca gagcaaattc atgagctgac taataaaggc       900
     cacgaaatta tttatatgcc gtgccatcgc agccatatgg attacttact acttacttat       960
     gctatttatc atcaaggttt agtaccacca catatagccg cgggtattaa ccttaacttt      1020
     tttccggcag gcgggatctt tcgccgctcg ggtgcgtttt ttattcgccg ttcatttgcc      1080
     ggtaataagc tctactctgc agtatttaaa gaatatttaa gccagttatt tattaaaggt      1140
     tactctgtta aattttatac cgagggcggg cgtagccgca ccgggcgttt gttaccacct      1200
     aaaacgggta tgttagcaat gaccatgcaa gctatgctgc gtggtattga ccgccctatt      1260
     tctattgtgc cggtatatat tggttacgag cacgttatgg aaattaacac gtaccttaaa      1320
     gaactcgctg gaaatgataa aaaaggtgag tctatctttg gaatttttaa agcgattaaa      1380
     aatcttaaaa actatggtcg aggttattta aactttggtg accctatttc cataaaccaa      1440
     tacttaaacg acaaccaacc caattggcgt gacgatatac accctaccga tgtacaaaaa      1500
     ccacaatggt taggcccaca agtggcaaac ctagccgacc aagttatggt taaaattaac      1560
     aatgcagcgg cacttaatgc agttaattta ttagcgatga ttttactggt aaacgacaag      1620
     catgcactga gtaagccaaa acttttagcg caacttgatt tttacttacg cttacaacgc      1680
     gacgccagct acagtaataa agtaacagct ccagaggaaa cgccagagca actgttaacg      1740
     catgcattaa agcttaataa gtttgatgtg ataagtgatg aatttggcga aattatcgcg      1800
     attaacgata aagaaaaaac actctttaat tattatcgta ataatatttt acatcttttt      1860
     gccgtaccaa gtttaattgc actgcatttg tttagagaaa aaaccacaac agtttcaaag      1920
     tgtcagcagc tagttgctgc gttttatccg ctatttgcta aagaatggta tttacgagag      1980
     ctagatgagg actacattac gcgtatttta gctaattttg tcgatcaaaa cttaatagaa      2040
     cttgatggcg ataacattca tataaccaat accaacgact gtttggctaa attggatatg      2100
     ttaggtaaag cactaaactt tacgttgcag cgttatgcca ttgtgattgg ctttatacaa      2160
     actagcaacg gcattgaaaa agcagagtta gagcgagaaa gccaagtgct agcacaacgc      2220
     ttaggtactt tgcatgggat taaaacccca gagttttttg ataaaaaggt gctggtcagc      2280
     tttattgata atttacgcgc acagtcttta attaccgatg gtgatgcggg cttaataggc      2340
     agcgtgcaat tatgtgaaac ttatatgcat cttaaagcat tattgccagc acgtgtttgg      2400
     cagtcaatta gcgatatagt acaaggtcag tgtaaataa                             2439
//

If you have problems or comments...

PBIL Back to PBIL home page