(data stored in ACNUC7421 zone)

EMBL: CR954246.PORA

CR954246.PORA        Location/Qualifiers
FT   CDS_pept        260899..261537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="porA"
FT                   /locus_tag="PSHAa0249"
FT                   /product="periplasmic protein, disulfide bond formation"
FT                   /function="3.3.7 : Protein folding"
FT                   /EC_number="5.3.4.1"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85352"
FT                   /db_xref="GOA:Q3ILM3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM3"
FT                   /protein_id="CAI85352.1"
FT                   /translation="MIKLVKAGLLAVLLPFAATSFAATFEEGVHYEVVSERATKKPEVK
FT                   EFFSFYCPACNNMEPLVAEIKPMLDKGVKFKKSHVDFVGVRDTEHQQMISQALATAEVL
FT                   PQKDKIIAAIFSHIHTKRANFNELADVKDVFVAQGVDGDKFDKLFKSFSVRTLSSKMKR
FT                   DQDYFKEKGALRGVPTFIVNGKYKLLLGRESGISEPADITKLINYLASK"
     atgataaaat tagttaaagc aggtttactt gctgtattac tacctttcgc tgcaacaagt        60
     tttgcagcaa cctttgagga aggtgtacat tatgaggttg tgtctgagcg cgcaactaaa       120
     aaaccagaag tgaaagagtt tttctcattt tactgtcctg cgtgtaataa catggagcca       180
     ctggtagccg agattaaacc aatgctcgat aaaggcgtaa aatttaaaaa gagccatgtt       240
     gattttgttg gcgtacgcga taccgagcat caacaaatga tcagccaagc gttagcaacg       300
     gctgaagtgt taccacaaaa agataaaatt attgcggcta tctttagtca cattcataca       360
     aagcgcgcaa attttaatga attagccgac gtaaaagatg tgtttgtagc gcaaggggtt       420
     gatggtgata agttcgataa gttatttaaa agcttttcgg tacgtacatt aagctcaaaa       480
     atgaagcgtg accaagatta ctttaaagag aaaggtgcat tgcgtggcgt acctactttt       540
     atcgtaaatg gtaagtacaa actacttcta ggtcgcgaat cgggtattag cgaaccagca       600
     gatatcacta aattaattaa ctacttagca agcaagtaa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page