(data stored in ACNUC7421 zone)

EMBL: CR954246.PPA

CR954246.PPA         Location/Qualifiers
FT   CDS_pept        complement(465647..466573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="PSHAa0445"
FT                   /product="inorganic pyrophosphatase, manganese-dependent"
FT                   /EC_number="3.6.1.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85542"
FT                   /db_xref="GOA:Q3IEI4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI4"
FT                   /protein_id="CAI85542.1"
FT                   /translation="MSMYVVGHKIPDSDSICGAIALAYLKNQINEPAIPTRLGEISPET
FT                   QFILDKFGFEAPELKLSYAGEDVYIVDHTEKTQAPDDIDQARIVGVVDHHKLGDLTSSA
FT                   PLECWIRPVGCSNTIIKMMYDFYNVEIPKNIAGIMMCAILSDTVIFKSPTCTTADIKCV
FT                   EALAEIAGIDDPKELGMEMFRVKSAVADTPIRDLVMRDFKDFNMNGNLVGIGQLEVIDL
FT                   AVFDDIKADLATDIAKLKTEGNRHSVFLLLTDIMKEGSEMLIASDDANLVEQAYGEKPA
FT                   DGKVWLDGVLSRKKQVVPPLQDAFQKV"
     atgtcaatgt atgtagtggg ccataaaatc ccagattcag attcaatatg cggtgcaatt        60
     gcactcgctt atttaaaaaa ccaaattaat gaaccagcca ttccaacgcg tcttggtgaa       120
     atttcaccag aaactcaatt tattcttgat aaatttggct tcgaagcgcc agagctaaag       180
     cttagctacg ccggcgaaga tgtgtatatt gttgaccaca cagaaaaaac ccaagcacca       240
     gatgatatag accaagcccg catagttggc gtggtagatc accataaact tggcgaccta       300
     acttcatcag caccactaga gtgttggatc cgccctgtag gttgttcaaa caccataatt       360
     aaaatgatgt acgattttta caatgtagaa atccctaaaa acatcgccgg tattatgatg       420
     tgcgctattt taagcgacac cgttattttt aaatcgccaa cgtgcactac tgccgatatt       480
     aaatgtgttg aagcgctagc agaaatagcc ggtattgacg atcctaaaga gctcggcatg       540
     gagatgtttc gcgttaaatc ggcagttgcc gacacgccta tacgcgacct ggttatgcgc       600
     gactttaaag actttaacat gaacggcaac ctagtaggta taggccagct agaagtgatc       660
     gaccttgcag tatttgacga tattaaagct gatttagcga ccgatatcgc caagcttaaa       720
     actgaaggta accgccactc agtattttta ctgcttaccg acatcatgaa agaaggctca       780
     gaaatgctaa ttgcatcaga cgacgcaaac ctagtagagc aagcttatgg tgaaaaacca       840
     gcagacggaa aagtatggct agacggcgta ctgagccgta aaaagcaagt agtaccacca       900
     ctacaagatg cttttcaaaa agtataa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page