(data stored in ACNUC7421 zone)

EMBL: CR954246.PPDD

CR954246.PPDD        Location/Qualifiers
FT   CDS_pept        complement(399118..399549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="PSHAa0384"
FT                   /product="putative prepilin peptidase dependent protein D"
FT                   /function="1.9 : Collective behaviour"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7959070, 10633126, 10811613; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85482"
FT                   /db_xref="GOA:Q3IIC6"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC6"
FT                   /protein_id="CAI85482.1"
FT                   /translation="MKTMTQQNQKGFTLIELMIVIAIIGILAAIALPQYQTYTKKARFS
FT                   EVVLAASSAKGLIDVCFQTRGAGSLANCDTDKKIGLTAGVADGAHVASVVIKPTDAEIT
FT                   ATGESTVDGATYILTPTVSTNAGTLTWAQTGDCVEKGVC"
     atgaaaacaa tgacacaaca gaaccaaaag ggtttcaccc taattgaatt aatgattgtt        60
     atcgcgatta tcggcattct tgccgcaatc gcattaccgc aataccaaac ctacactaaa       120
     aaagcacgtt tttctgaagt tgtactagct gcttcttcag cgaaaggact tatagatgta       180
     tgtttccaaa ctcgtggagc tggtagttta gcaaattgcg atactgacaa aaagattggt       240
     ttaactgcag gtgtagctga cggcgcacac gtggctagcg ttgtgattaa gccaactgat       300
     gctgaaatta cagcaactgg cgagtcaact gttgatggtg ctacatatat tttaacacct       360
     actgtaagta ctaatgcagg cacattaaca tgggcccaaa caggtgactg tgtggaaaaa       420
     ggcgtttgct aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page