(data stored in ACNUC7421 zone)

EMBL: CR954246.PRFB

CR954246.PRFB        Location/Qualifiers
FT   CDS_pept        join(531558..531632,531634..532656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="PSHAa0517"
FT                   /product="peptide chain release factor 2 (RF-2)"
FT                   /function="3.3.5 : Termination"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3889910, 11118225, 2456575; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85607"
FT                   /db_xref="GOA:Q3ILD8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILD8"
FT                   /protein_id="CAI85607.1"
FT                   /translation="MFEVNPVINQIKEIRERTELLRGYLDYALKQERLEEVNAELEDSA
FT                   VWNEPERAQALGREKSALEAVVETIDTLVTGTDDVEGLLELAVEAEDQETFDEAQSELA
FT                   DLNEQLEALEFRRMFSGPHDSNDAYLDLQSGSGGTEAQDWCNILLRMYLRWGEAKGFKV
FT                   ELVEATGGDVAGIKGATVRFVGEYAYGWLRTETGVHRLVRKSPFDSSGRRHTSFASAFV
FT                   YPEVDDNIEIDMNPSDLRIDVYRASGAGGQHVNTTESAVRITHVPTNTVVQCQNERSQH
FT                   KNKAQAMKQLKAKLFELELQQQNAEKQTQEDSKSDIGWGSQIRSYVLDDARIKDLRTGV
FT                   ESRNTQSVLDGNLDKFIEASLKSGL"
     atgtttgaag tgaatcctgt gattaaccaa atcaaggaaa ttcgcgaacg tactgagttg        60
     cttcgggggt accttgacta tgctcttaaa caagaacgct tagaagaagt taacgccgaa       120
     cttgaagact cagccgtatg gaatgaacct gaacgcgcac aagctctcgg ccgtgaaaag       180
     tcggcattag aagctgttgt tgaaactatc gatactttag tgacgggtac tgacgacgtt       240
     gaaggcttac ttgagcttgc tgtagaagcc gaagatcaag aaacctttga tgaagcacaa       300
     agcgaactag cagacttgaa cgagcaacta gaagcgttag agtttcgtcg tatgtttagc       360
     ggtcctcatg actcaaacga cgcttacctt gatttacaat ctggttctgg cggcactgaa       420
     gcacaagact ggtgtaatat tttgctgcgc atgtatttac gctggggcga agctaaaggc       480
     tttaaagttg aattagtaga agcaactggt ggcgatgttg caggaattaa aggcgcaaca       540
     gttcgctttg ttggcgaata cgcgtatggt tggttacgta ccgaaactgg cgtgcatcgt       600
     ttagtgcgaa aaagcccgtt tgactcaagt ggtcgtcgtc atacttcgtt tgcctctgca       660
     tttgtttacc cagaagttga cgacaatatt gaaattgata tgaacccgtc tgacttacgt       720
     attgacgttt accgtgcctc gggcgcaggt ggtcagcacg ttaacaccac tgaatcagcg       780
     gttcgtatta cgcacgtacc aacaaatacc gtagtgcagt gccaaaatga gcgctcacaa       840
     cataaaaata aagcccaagc aatgaaacag ttaaaagcaa aattgtttga gctagagtta       900
     caacagcaaa atgctgaaaa acaaacccaa gaagactcaa agtcggacat tggttggggc       960
     agtcaaattc gttcatacgt actcgatgac gctcgcatta aagatttacg tacaggcgtt      1020
     gaaagccgta atacccaatc ggtacttgac ggcaacttag acaaatttat agaagccagc      1080
     ttaaaatctg gtttataa                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page